1. Тип контента




2. Первоначальная сортировка
3. Дополнительные фильтры





Поиск
результаты
Найденое количество: 2370 записей. Отображается не более 100.
SETT ATT FORMA OCH KONDITIONERA ETT HAL I LOS MARK OCH ANORDNING FOR DETTA
Патент от
17 мая 1981 года

Заявител(и)ь: ATLAS COPCO AB

Изобретател(и)ь: LAVON E V

Номер заявки:

Дата заявки: 17.05.1981

Классификация: E21C37-12, E21C0037120000

Дата международной регистрации:

Международные идентификаторы:

Вес (релевантность к запросу): 2709.1943


SETT ATT FORMA OCH KONDITIONERA ETT HAL I LOS MARK OCH ANORDNING ... SETT ATT FORMA OCH KONDITIONERA ETT HAL I LOS MARK OCH ANORDNING ... - SETT ATT FORMA OCH KONDITIONERA ETT HAL I LOS MARK OCH ANORDNING ... ) SETT ATT FORMA OCH KONDITIONERA ETT HAL I LOS MARK OCH ANORDNING ... SETT ATT FORMA OCH KONDITIONERA ETT HAL I LOS MARK OCH ANORDNING ... - SETT ATT FORMA OCH KONDITIONERA ETT HAL I LOS MARK OCH ANORDNING ... ) SETT ATT FORMA OCH KONDITIONERA ETT HAL I LOS MARK OCH ANORDNING ...
SETT OCH ANORDNING FOR BRYTNING AV ETT FAST MATERIAL
Патент от
20 марта 1977 года

Заявител(и)ь: ATLAS COPCO AB

Изобретател(и)ь: LAVON E V

Номер заявки:

Дата заявки: 20.03.1977

Классификация: B28D1-00, B28D1-26, E21C37-06, E21C37-12, F41B9-0015, F41B9-0031, F41B9-0087, F42D1-10, E21C0025600000, B02C0001000000, E21C0037060000, E21C0037120000

Дата международной регистрации:

Международные идентификаторы:

Вес (релевантность к запросу): 2709.1943


... OCH ANORDNING FOR BRYTNING AV ETT FAST MATERIAL. SE395503 SETT OCH ... ANORDNING FOR BRYTNING AV ETT FAST MATERIAL /* When the drawerTriggering ... OCH ANORDNING FOR BRYTNING AV ETT FAST MATERIAL Нац. библиограф. данныеPrimeFaces ... OCH ANORDNING FOR BRYTNING AV ETT FAST MATERIAL Реферат # - if(typeof ... OCH ANORDNING FOR BRYTNING AV ETT FAST MATERIAL /* When the drawerTriggering ... OCH ANORDNING FOR BRYTNING AV ETT FAST MATERIAL Нац. библиограф. данныеPrimeFaces ... OCH ANORDNING FOR BRYTNING AV ETT FAST MATERIAL Реферат # - if(typeof ...
SETT OCH ANORDNING FOR BRYTNING AV ETT FAST MATERIAL
Патент от
29 декабря 1977 года

Заявител(и)ь: ATLAS COPCO AB

Изобретател(и)ь: LAVON E V

Номер заявки:

Дата заявки: 29.12.1977

Классификация: B05B12-06, B26F3-004, E21D9-1066, E21C0037060000, B05B0012060000, B26F0003000000, E21C0025600000, E21C0037120000, E21C0045000000, E21D0009100000

Дата международной регистрации:

Международные идентификаторы:

Вес (релевантность к запросу): 2709.1943


... OCH ANORDNING FOR BRYTNING AV ETT FAST MATERIAL. SE7607337 SETT OCH ... ANORDNING FOR BRYTNING AV ETT FAST MATERIAL /* When the drawerTriggering ... OCH ANORDNING FOR BRYTNING AV ETT FAST MATERIAL Нац. библиограф. данныеPrimeFaces ... OCH ANORDNING FOR BRYTNING AV ETT FAST MATERIAL Реферат # - if(typeof ... OCH ANORDNING FOR BRYTNING AV ETT FAST MATERIAL /* When the drawerTriggering ... OCH ANORDNING FOR BRYTNING AV ETT FAST MATERIAL Нац. библиограф. данныеPrimeFaces ... OCH ANORDNING FOR BRYTNING AV ETT FAST MATERIAL Реферат # - if(typeof ...
SETT OCH ANORDNING FOR BRYTNING AV ETT FAST MATERIAL
Патент от
20 марта 1977 года

Заявител(и)ь: ATLAS COPCO AB

Изобретател(и)ь: LAVON E V

Номер заявки:

Дата заявки: 20.03.1977

Классификация: B28D1-00, E21C37-12, F42D1-00, B28D0001000000, E21C0037120000, F42D0001000000

Дата международной регистрации:

Международные идентификаторы:

Вес (релевантность к запросу): 2709.1943


... OCH ANORDNING FOR BRYTNING AV ETT FAST MATERIAL. SE422967 SETT OCH ... ANORDNING FOR BRYTNING AV ETT FAST MATERIAL /* When the drawerTriggering ... OCH ANORDNING FOR BRYTNING AV ETT FAST MATERIAL Нац. библиограф. данныеPrimeFaces ... OCH ANORDNING FOR BRYTNING AV ETT FAST MATERIAL Реферат # - if(typeof ... OCH ANORDNING FOR BRYTNING AV ETT FAST MATERIAL /* When the drawerTriggering ... OCH ANORDNING FOR BRYTNING AV ETT FAST MATERIAL Нац. библиограф. данныеPrimeFaces ... OCH ANORDNING FOR BRYTNING AV ETT FAST MATERIAL Реферат # - if(typeof ...
SETT OCH ANORDNING FOR BRYTNING AV ETT FAST MATERIAL
Патент от
28 января 1980 года

Заявител(и)ь: ATLAS COPCO AB

Изобретател(и)ь: LAVON E V

Номер заявки:

Дата заявки: 28.01.1980

Классификация: E21C37-12, E21C

Дата международной регистрации:

Международные идентификаторы:

Вес (релевантность к запросу): 2709.1943


... OCH ANORDNING FOR BRYTNING AV ETT FAST MATERIAL. SE8000632 SETT OCH ... ANORDNING FOR BRYTNING AV ETT FAST MATERIAL /* When the drawerTriggering ... OCH ANORDNING FOR BRYTNING AV ETT FAST MATERIAL Нац. библиограф. данныеPrimeFaces ... OCH ANORDNING FOR BRYTNING AV ETT FAST MATERIAL Реферат # - if(typeof ... OCH ANORDNING FOR BRYTNING AV ETT FAST MATERIAL /* When the drawerTriggering ... OCH ANORDNING FOR BRYTNING AV ETT FAST MATERIAL Нац. библиограф. данныеPrimeFaces ... OCH ANORDNING FOR BRYTNING AV ETT FAST MATERIAL Реферат # - if(typeof ...
SETT OCH ANORDNING FOR BRYTNING AV ETT FAST MATERIAL
Патент от
20 марта 1977 года

Заявител(и)ь: ATLAS COPCO AB

Изобретател(и)ь: LAVON E V;KARLFORS L J

Номер заявки:

Дата заявки: 20.03.1977

Классификация: B28D1-00, E02F3-8883, E02F5-305, E21C37-12, E21D9-006, F42D1-04, F42D1-10, F42D3-04, E02F0005300000, E21C0037120000, E21D0009000000, F42D0001040000, F42D0003000000, F42D0003040000, F42D0099000000

Дата международной регистрации:

Международные идентификаторы:

Вес (релевантность к запросу): 2709.1943


... OCH ANORDNING FOR BRYTNING AV ETT FAST MATERIAL. SE395746 SETT OCH ... ANORDNING FOR BRYTNING AV ETT FAST MATERIAL /* When the drawerTriggering ... OCH ANORDNING FOR BRYTNING AV ETT FAST MATERIAL Нац. библиограф. данныеPrimeFaces ... OCH ANORDNING FOR BRYTNING AV ETT FAST MATERIAL Реферат # - if(typeof ... OCH ANORDNING FOR BRYTNING AV ETT FAST MATERIAL /* When the drawerTriggering ... OCH ANORDNING FOR BRYTNING AV ETT FAST MATERIAL Нац. библиограф. данныеPrimeFaces ... OCH ANORDNING FOR BRYTNING AV ETT FAST MATERIAL Реферат # - if(typeof ...
ANORDNING VID ETT HYDRAULISKT DRIVSYSTEM ANSLUTET TILL EN LASTDRIVANDE HYDRAULMOTOR
Патент от
19 ноября 1988 года

Заявител(и)ь: ATLAS COPCO AB

Изобретател(и)ь: WENNERBO OE E V;NILSTAM B

Номер заявки:

Дата заявки: 19.11.1988

Классификация: F15B13-0422, Y10T137-86582, Y10T137-87185, F15B0013042000

Дата международной регистрации:

Международные идентификаторы:

Вес (релевантность к запросу): 2709.1943


... LASTDRIVANDE HYDRAULMOTOR. SE458704 ANORDNING VID ETT HYDRAULISKT DRIVSYSTEM ANSLUTET TILL EN ... ('gotoForm:gotoApplicationNumber');}); 1. SE458704 - ANORDNING VID ETT HYDRAULISKT DRIVSYSTEM ANSLUTET TILL EN ... SE Название (SV) ANORDNING VID ETT HYDRAULISKT DRIVSYSTEM ANSLUTET TILL EN ... .js.jsf'); SE458704 ANORDNING VID ETT HYDRAULISKT DRIVSYSTEM ANSLUTET TILL EN ... ('gotoForm:gotoApplicationNumber');}); 1. SE458704 - ANORDNING VID ETT HYDRAULISKT DRIVSYSTEM ANSLUTET TILL EN ... SE Название (SV) ANORDNING VID ETT HYDRAULISKT DRIVSYSTEM ANSLUTET TILL EN ...
PROSEKTIL FOR BRYTNING AV ETT FAST MATERIAL
Патент от
02 октября 1978 года

Заявител(и)ь: ATLAS COPCO AB

Изобретател(и)ь: LAVON E V;KARLFORS L J

Номер заявки:

Дата заявки: 02.10.1978

Классификация: E21C37-12, E21C0037120000

Дата международной регистрации:

Международные идентификаторы:

Вес (релевантность к запросу): 2709.1943


PROSEKTIL FOR BRYTNING AV ETT FAST MATERIAL. SE404396 PROSEKTIL FOR ... BRYTNING AV ETT FAST MATERIAL /* When the drawerTriggering ... ');}); 1. SE404396 - PROSEKTIL FOR BRYTNING AV ETT FAST MATERIAL Нац. библиограф. данныеPrimeFaces ... (SV) PROSEKTIL FOR BRYTNING AV ETT FAST MATERIAL Реферат # - if(typeof ... '); SE404396 PROSEKTIL FOR BRYTNING AV ETT FAST MATERIAL /* When the drawerTriggering ... ');}); 1. SE404396 - PROSEKTIL FOR BRYTNING AV ETT FAST MATERIAL Нац. библиограф. данныеPrimeFaces ... (SV) PROSEKTIL FOR BRYTNING AV ETT FAST MATERIAL Реферат # - if(typeof ...
ANORDNING VID BERGBORRMASKINER FOR DEMPNING AV REKYLEN FRAN ETT TILL MASKINEN ANSLUTET ARBETSVERKTYG
Патент от
19 сентября 1976 года

Заявител(и)ь: ATLAS COPCO AB

Изобретател(и)ь: EKLOEF AA T;ROMELL G V R;FENGSBORN P T A

Номер заявки:

Дата заявки: 19.09.1976

Классификация: B25D9-12, B25D17-245, F01L25-066, F03C1-002, F03C1-005, Y10S173-04, B25D0009120000, B25D0017240000, E21B0001000000, E21B0001260000, E21B0001380000, F01L0025060000, F03C0001000000

Дата международной регистрации:

Международные идентификаторы:

Вес (релевантность к запросу): 2709.1943


... FOR DEMPNING AV REKYLEN FRAN ETT TILL MASKINEN ANSLUTET ARBETSVERKTYG. SE392830 ... FOR DEMPNING AV REKYLEN FRAN ETT TILL MASKINEN ANSLUTET ARBETSVERKTYG /* When ... FOR DEMPNING AV REKYLEN FRAN ETT TILL MASKINEN ANSLUTET ARBETSVERKTYG Нац ... FOR DEMPNING AV REKYLEN FRAN ETT TILL MASKINEN ANSLUTET ARBETSVERKTYG Реферат ... FOR DEMPNING AV REKYLEN FRAN ETT TILL MASKINEN ANSLUTET ARBETSVERKTYG /* When ... FOR DEMPNING AV REKYLEN FRAN ETT TILL MASKINEN ANSLUTET ARBETSVERKTYG Нац ... FOR DEMPNING AV REKYLEN FRAN ETT TILL MASKINEN ANSLUTET ARBETSVERKTYG Реферат ...
ANORDNING VID SLAAENDE MASKINER SAASOM BERGBORRMASKINER FOER DAEMPNING AV REKYLEN FRAAN ETT TILL MASKINEN ANSLUTET ARBETSVERKTYG
Патент от
19 сентября 1976 года

Заявител(и)ь: ATLAS COPCO AB

Изобретател(и)ь: EKLOEF AA T;ROMELL G V R;FENGSBORN P T A

Номер заявки:

Дата заявки: 19.09.1976

Классификация: B25D9-12, B25D17-245, F01L25-066, F03C1-002, F03C1-005, Y10S173-04, B25D0009120000, B25D0017240000, E21B0001000000, E21B0001260000, E21B0001380000, F01L0025060000, F03C0001000000

Дата международной регистрации:

Международные идентификаторы:

Вес (релевантность к запросу): 2709.1943


... FOER DAEMPNING AV REKYLEN FRAAN ETT TILL MASKINEN ANSLUTET ARBETSVERKTYG. SE457936 ... FOER DAEMPNING AV REKYLEN FRAAN ETT TILL MASKINEN ANSLUTET ARBETSVERKTYG /* When ... FOER DAEMPNING AV REKYLEN FRAAN ETT TILL MASKINEN ANSLUTET ARBETSVERKTYG Нац ... FOER DAEMPNING AV REKYLEN FRAAN ETT TILL MASKINEN ANSLUTET ARBETSVERKTYG Реферат ... FOER DAEMPNING AV REKYLEN FRAAN ETT TILL MASKINEN ANSLUTET ARBETSVERKTYG /* When ... FOER DAEMPNING AV REKYLEN FRAAN ETT TILL MASKINEN ANSLUTET ARBETSVERKTYG Нац ... FOER DAEMPNING AV REKYLEN FRAAN ETT TILL MASKINEN ANSLUTET ARBETSVERKTYG Реферат ...
PROCESS FOR PRODUCING RETROGRADATION RESISTANT READY-TO-EAT ASIAN NOODLES
Патент от
19 сентября 2016 года

Заявител(и)ь: AZANZA, PATRICIA;MITZI CYRELLE B. MANUEL;MARIA LORINA C. MORALES;KRISTIA MAY T. MARTE

Изобретател(и)ь: PATRICIA V. AZANZA;MARIA LORINA C. MORALES;KRISTIA MAY T. MARTE;MITZI CYRELLE B. MANUEL

Номер заявки:

Дата заявки: 19.09.2016

Классификация: A23L0001000000, A23L0003000000, A23L0001160000

Дата международной регистрации:

Международные идентификаторы:

Вес (релевантность к запросу): 2709.1943


... PRODUCING RETROGRADATION RESISTANT READY-TO-EAT ASIAN NOODLES. PH1/2015/000077 ... PRODUCING RETROGRADATION RESISTANT READY-TO-EAT ASIAN NOODLES /* When the drawerTriggering ... PRODUCING RETROGRADATION RESISTANT READY-TO-EAT ASIAN NOODLES Нац. библиограф. данныеДокументыPrimeFaces ... PRODUCING RETROGRADATION RESISTANT READY-TO-EAT ASIAN NOODLES Реферат # - if(typeof ... PRODUCING RETROGRADATION RESISTANT READY-TO-EAT ASIAN NOODLES /* When the drawerTriggering ... PRODUCING RETROGRADATION RESISTANT READY-TO-EAT ASIAN NOODLES Нац. библиограф. данныеДокументыPrimeFaces ... PRODUCING RETROGRADATION RESISTANT READY-TO-EAT ASIAN NOODLES Реферат # - if(typeof ...
Kombinerat aktivt och passivt benprotessystem samt en metod för att utföra en rörelsecykel med ett sådant system
Патент от
20 октября 2006 года

Заявител(и)ь: GRAMNAES LISA

Изобретател(и)ь: GRAMNAES LISA

Номер заявки:

Дата заявки: 20.10.2006

Классификация: A61F2-68, A61F2-64, A61F2-66, A61F2-6607, A61F2-70, A61F2-72, A61F2002-5038, A61F2002-607, A61F2002-6614, A61F2002-6818, A61F2002-704, A61F2002-705, A61F2002-741, A61F2002-745, A61F2002-748, A61F2002-7625, A61F2002-763, A61F2002-764, A61F2002-7655, A61F0002680000, A61F0002640000, A61F0002660000

Дата международной регистрации:

Международные идентификаторы:

Вес (релевантность к запросу): 2709.1943


... utföra en rörelsecykel med ett sådant system. Также опубликовано в следующем ... utföra en rörelsecykel med ett sådant system /* When the drawerTriggering ... utföra en rörelsecykel med ett sådant system Нац. библиограф. данныеPrimeFaces ... utföra en rörelsecykel med ett sådant system Реферат Также опубликовано ... utföra en rörelsecykel med ett sådant system /* When the drawerTriggering ... utföra en rörelsecykel med ett sådant system Нац. библиограф. данныеPrimeFaces ... utföra en rörelsecykel med ett sådant system Реферат Также опубликовано ...
Drivanordning för ett armdrivet fordon
Патент от
04 ноября 1996 года

Заявител(и)ь: JONNY BORG

Изобретател(и)ь: BORG JONNY

Номер заявки:

Дата заявки: 04.11.1996

Классификация: B62M1-14, B62K3-002, B62K0003000000, B62M0001000000, B62M0001140000

Дата международной регистрации:

Международные идентификаторы:

Вес (релевантность к запросу): 2709.1943


Drivanordning för ett armdrivet fordon. Также опубликовано в следующем ... WO/1996/034791 SE507485 Drivanordning för ett armdrivet fordon /* When the drawerTriggering ... .focus('gotoForm:gotoApplicationNumber');}); 1. SE507485 - Drivanordning för ett armdrivet fordon Нац. библиограф. данныеPrimeFaces ... .1995 SE Название (SV) Drivanordning för ett armdrivet fordon Реферат Также опубликовано ... -hotkeys.js.jsf'); SE507485 Drivanordning för ett armdrivet fordon /* When the drawerTriggering ... .focus('gotoForm:gotoApplicationNumber');}); 1. SE507485 - Drivanordning för ett armdrivet fordon Нац. библиограф. данныеPrimeFaces ... .1995 SE Название (SV) Drivanordning för ett armdrivet fordon Реферат Также опубликовано ...
Heizofen
Патент от
30 апреля 2018 года

Заявител(и)ь: ЭНКЕА БИОТЕК Б.В.

Изобретател(и)ь: Арслан Фатих

Номер заявки:

Дата заявки: 30.04.2018

Классификация: A61K2039-505, A61K2039-54, A61K2039-545, C07K16-18, C07K2317-34, A61P7-06, A61P9-00, A61P9-10, A61K39-39541, C07K16-24, C07K0016180000

Дата международной регистрации:

Международные идентификаторы:

Вес (релевантность к запросу): 2692.554


Heizofen. (DE) Heizofen (10, 33, 46, 51) für Wärmekabinen, Saunen oder dergleichen, mit einem Gehäuse (11), einer im Gehäuse aufgenommenen Heizvorrichtung (12) zur Erzeugung von Heißluft, einer Heißluftlenkungsvorrichtung und einer Wärmespeichervorrichtung (14, 35) zur Speicherung von Wärmeenergie der Heizvorrichtung, dadurch gekennzeichnet, dass die Heißluftlenkungsvorrichtung einen ersten Luftkanal (23, 38) umfasst, der Heißluft der Heizvorrichtung aus dem Gehäuse unterbrechungsfrei in eine Kabine (30) leiten kann, wobei in einem ersten Luftstrom (24, 41) des ersten Luftkanals die Wärmespeichervorrichtung angeordnet ist, wobei die Heißluftlenkungsvorrichtung einen zweiten Luftkanal (26, 39) umfasst, der Heißluft der Heizvorrichtung aus dem Gehäuse in die Kabine leiten kann, wobei ein zweiter Luftstrom (29, 45) des zweiten Luftkanals an der Wärmespeichervorrichtung vorbei geleitet werden kann, wobei die Heißluftlenkungsvorrichtung eine Absperreinheit (31) umfasst, mittels der der zweite Luftstrom in dem zweiten Luftkanal unterbrochen werden kann. #de_desc a {text-decoration: none;color:blue;} #de_desc a:visited {color: blue;} #de_desc .bar {font-family: Code 39; font-size: 160%;} #de_desc .break_avoid {page-break-inside: avoid;} #de_desc .break_before {page-break-before: always;} #de_desc.novs {margin-top:1em; margin-bottom:0em;} #de_desc {margin-left:10pt; margin-right:10pt; text-align:justify; line-height:133%;} #de_desc .dec {margin-left:3em; position:relative;} #de_desc * {padding:0; margin:0} #de_desc .dtTable { width: 8em; font-weight:bolder;} #de_desc .deChemistry {display:block; margin-top:1em; margin-bottom:1em; text-align:center; margin-left:auto; margin-right:auto;} #de_desc .deChemistryLeft {display:block; margin-top:1em; margin-bottom:1em;} #de_desc .deMath {display:block; margin-top:1em; margin-bottom:1em;} #de_desc .deMathCenter {display:block; text-align:center; margin-top:1em; margin-bottom:1em; margin-left:auto; margin-right:auto;} #de_desc .deMathInline {display:inline-block;} #de_desc . ...
Ett styrsystem och ett förfarande avsett att användas vid utförande av kliniska studier
Патент от
20 августа 2002 года

Заявител(и)ь: NORDIC MAN OF CLINICAL TRIAL A

Изобретател(и)ь: FOUREAUX OLA;KAEPPI MARCUS

Номер заявки:

Дата заявки: 20.08.2002

Классификация: G06Q10-02, G16H10-20, G16H10-60, G16H70-40, A61B5-00, A61B5-0002, G16H40-00, G06F0019000000

Дата международной регистрации:

Международные идентификаторы:

Вес (релевантность к запросу): 2679.156


Ett styrsystem och ett förfarande avsett att användas ... WO/2002/067179 SE0100606 Ett styrsystem och ett förfarande avsett att anv ... .focus('gotoForm:gotoApplicationNumber');}); 1. SE0100606 - Ett styrsystem och ett förfarande avsett att anv ... .2001 SE Название (SV) Ett styrsystem och ett förfarande avsett att anv ... -hotkeys.js.jsf'); SE0100606 Ett styrsystem och ett förfarande avsett att anv ... .focus('gotoForm:gotoApplicationNumber');}); 1. SE0100606 - Ett styrsystem och ett förfarande avsett att anv ... .2001 SE Название (SV) Ett styrsystem och ett förfarande avsett att anv ...
УСТРОЙСТВО ДЛЯ УДАРНО-ИМПУЛЬСНОЙ ОЧИСТКИ ПОВЕРХНОСТЕЙ КОТЛОВ
Патент от
20 марта 1976 года

Заявител(и)ь: SPS TECHNOLOGIES

Изобретател(и)ь: BOYS J T

Номер заявки:

Дата заявки: 20.03.1976

Классификация: B25B23-1456, G01L3-109, G01D0001000000, B25B0023140000, B25B0023145000, B25B0023151000, G01L0003100000, G01L0005240000, G01N0019000000

Дата международной регистрации:

Международные идентификаторы:

Вес (релевантность к запросу): 2679.156


УСТРОЙСТВО ДЛЯ УДАРНО-ИМПУЛЬСНОЙ ОЧИСТКИ ПОВЕРХНОСТЕЙ КОТЛОВ. (EN) FIELD: heat-power engineering; cleaning of boiler heating surfaces from ash deposits in any technological process requiring shock-wave generators. SUBSTANCE: device for shock-pulse cleaning of boiler has shock pipe, explosion chamber and lock to let in explosive and initiate explosion. Explosion chamber is made in form of two-layer cylinder mated through threaded joint with shock pipe and lock which accommodates blasting mechanism and device blocking blast in process of recharging and under any emergency conditions, including operator's fault. Blocking device is made in form of plate with hole installed for movement in lock by means of flexible member and stop. EFFECT: provision of shock-wave generator with improved performance characteristics, enhanced reliability and efficiency in operation. 3 cl, 2 dwg(RU) Изобретение относится к теплоэнергетике, в частности к устройству для ударно-импульсной очистки поверхностей нагрева котлов от зольных отложений и может быть использовано в любом технологическом процессе, где есть необходимость в генераторе ударных волн. Изобретение направлено на создание генератора ударных волн с улучшенными технико-эксплуатационными характеристиками, в том числе на повышение надежности и эффективности в работе. Устройство для ударно-импульсной очистки котлов включает ударную трубу, камеру взрыва и затвор для ввода взрывчатого вещества и его инициирования. Камера взрыва выполнена из двухслойного цилиндра, сопряженного при помощи резьбового соединения с ударной трубой и затвором, в котором установлены механизм подрыва и устройства, блокирующие подрыв во время перезарядки и любой нештатной ситуации, включая ошибку оператора. Блокиратор выполнен в виде пластины с отверстием, подвижно закрепленной внутри затвора с помощью упругого элемента и фиксатора. 2 з.п. ф-лы, 2 ил. ОПИСАНИЕ Изобретение относитс к теплоэнергетике, а именно к средствам очистки поверхностей нагрева энергетических и водогрейных котельных агрегатов от наружных ...
СИСТЕМА СПУТНИКОВОЙ СВЯЗИ
Патент от
03 апреля 2008 года

Заявител(и)ь: ATLAS ROBERT D

Изобретател(и)ь: ATLAS Robert D.

Номер заявки:

Дата заявки: 03.04.2008

Классификация: B01J0019080000

Дата международной регистрации:

Международные идентификаторы:

Вес (релевантность к запросу): 2678.0745


СИСТЕМА СПУТНИКОВОЙ СВЯЗИ. (RU) Настоящее изобретение относится к системе спутниковой связи, включающей в себя мобильный пользовательский терминал. Для создания системы спутниковой связи, обеспечивающей в любой заданной области земной поверхности связь с мобильным пользовательским терминалом через обычные спутники связи, на наклоненной орбите эксплуатируют квази-геостационарный спутник, передающий сигнал s'(t) нисходящей линии связи с расширенным спектром в заданную область земной поверхности, который принимается и сжимается по спектру мобильным пользовательским терминалом. Также опубликовано в следующем виде AU2002214994 BRPI0114174 CA2422601 CN1455992 EP1320949 JP2004510393 US20030181161 WO/2002/027976 Oписание [0001] Настоящее изобретение относится к системе спутниковой связи. Более конкретно, настоящее изобретение относится к способу облучения заданной области земной поверхности сигналом, нисходящей линии связи, который должен приниматься мобильным пользовательским терминалом. [0002] Спутники связи, особенно те из них, что находятся на геостационарной околоземной орбите (ГОО), обеспечивают эффективную платформу для ретрансляции радиосигналов с наземной станции на множество параболических антенн, предназначенных для непосредственного приема спутникового вещания. Коммерческая система спутниковой связи состоит из космического сегмента и наземного сегмента. В принципе, космическая система из состава ГОО-системы включает в себя спутник, функционирующий на орбите, и аппаратуру слежения, телеметрии и выдачи команд (СТиК), которая управляет функционированием спутника. [0003] Для фактического приема услуг большинства из существующих геостационарных спутниковых систем пользователю требуется пятидесятисантиметровая параболическая антенна, предназначенная для практически безошибочного приема. При использовании этого типа антенны для мобильного пользовательского терминала необходимо автоматическое слежение. Однако, автоматическое слежение можно реализовать только посредством слежения за установленным на спутнике маяком в ...
СИСТЕМА РАДИОСВЯЗИ С ПОДВИЖНЫМИ ОБЪЕКТАМИ С ПРИМЕНЕНИЕМ РАДИОФОТОННЫХ ЭЛЕМЕНТОВ
Патент от
12 декабря 2017 года

Заявител(и)ь: JUAN CARLOS VEGA

Изобретател(и)ь: JUAN CARLOS VEGA

Номер заявки:

Дата заявки: 12.12.2017

Классификация: F16K0017000000, E21B0043000000

Дата международной регистрации:

Международные идентификаторы:

Вес (релевантность к запросу): 2678.0745


СИСТЕМА РАДИОСВЯЗИ С ПОДВИЖНЫМИ ОБЪЕКТАМИ С ПРИМЕНЕНИЕМ РАДИОФОТОННЫХ ЭЛЕМЕНТОВ. (EN) FIELD: radio engineering and communications. SUBSTANCE: invention relates to data exchange systems and can be used for implementation of information exchange via radio channels between ground systems (GS) and sources (recipients) of information located on aerial mobile objects (MO). Technical result is achieved due to introduction into onboard antenna-feeder paths of non-distorting phase-frequency and amplitude-frequency characteristics of nodes on radio-photon elements, controlled by onboard computer and distribution of n onboard wide-range antennae, and n onboard wide-band radio-frequency receiving-transmitting modules into four groups, each of which generates its beam pattern in the corresponding hemisphere shifted relative to neighboring hemispheres by 90°. For this purpose, the radio communication system with the use of radio-photon elements additionally includes not distorting the shape and spectrum of radio signals nodes on radio-photon elements, which are managed and controlled by two-way links connected to the corresponding inputs/outputs of the onboard computer. EFFECT: high noise-immunity of the radio communication system and longer range of stable communication. 1 cl, 2 dwg(RU) Изобретение относится к системам обмена данными и может быть использовано для реализации информационного обмена по радиоканалам между наземными комплексами (НК) и источниками (получателями) информации, расположенными на воздушных подвижных объектах (ПО). Технический результат состоит в повышении помехозащищенности системы радиосвязи и увеличении дальности устойчивой связи за счет введения в бортовые антенно-фидерные тракты не искажающих фазочастотную и амплитудно-частотную характеристики узлов на радиофотонных элементах, управляемых с помощью бортового вычислителя и распределения n бортовых широкодиапазонных антенн, и n бортовых широкодиапазонных радиочастотных приемо-передающих модулей на четыре группы, каждая из которых формирует свою ...
SpaceX запустила к МКС новейший корабль с манекеном на борту
Патент от
29 ноября 2013 года

Заявител(и)ь: OHB SWEDEN AB

Изобретател(и)ь: BATTELINO MILAN;VANNEVIK ANDERS EDFORS

Номер заявки:

Дата заявки: 29.11.2013

Классификация: B64G1-242, B64G1-1085, B64G1-26, B64G1-244, B64G0001240000, G05D0001080000

Дата международной регистрации:

Международные идентификаторы:

Вес (релевантность к запросу): 2666.0469


SpaceX запустила к МКС новейший корабль с манекеном на борту. Crew Dragon был выведен на орбиту ракетой-носителем Falcon 9
A ready to eat potato product having less than 17% fat, prepared by frying dehydrated whole potato pieces
Патент от
11 апреля 2013 года

Заявител(и)ь: Crunch Time Snacks

Изобретател(и)ь: Leech, Gary;McKellar, Angus;McLaughlin, David

Номер заявки:

Дата заявки: 11.04.2013

Классификация:

Дата международной регистрации:

Международные идентификаторы:

Вес (релевантность к запросу): 2666.0469


A ready to eat potato product having less than ... potato pieces. AU2013900998 A ready to eat potato product having less than ... ('gotoForm:gotoApplicationNumber');}); 1. AU2013900998 - A ready to eat potato product having less than ... Snacks Название (EN) A ready to eat potato product having less than ... .js.jsf'); AU2013900998 A ready to eat potato product having less than ... ('gotoForm:gotoApplicationNumber');}); 1. AU2013900998 - A ready to eat potato product having less than ... Snacks Название (EN) A ready to eat potato product having less than ...
EXPLOSIVE DETECTION AND IDENTIFICATION (EDI) KIT
Патент от
08 июня 2015 года

Заявител(и)ь: PHILIPPINE ARMY

Изобретател(и)ь: ENGELBERT F. AVENA;EUGENE F.LAGUE (OS) PA

Номер заявки:

Дата заявки: 08.06.2015

Классификация: G01N0031220000, G01N0033220000

Дата международной регистрации:

Международные идентификаторы:

Вес (релевантность к запросу): 2666.0469


EXPLOSIVE DETECTION AND IDENTIFICATION (EDI) KIT. (EN) The scientific method ... /000350 EXPLOSIVE DETECTION AND IDENTIFICATION (EDI) KIT /* When the drawerTriggering element ... /000350 - EXPLOSIVE DETECTION AND IDENTIFICATION (EDI) KIT Нац. библиограф. данныеДокументыPrimeFaces.cw ... (EN) EXPLOSIVE DETECTION AND IDENTIFICATION (EDI) KIT Реферат (EN) The scientific ... /000350 EXPLOSIVE DETECTION AND IDENTIFICATION (EDI) KIT /* When the drawerTriggering element ... /000350 - EXPLOSIVE DETECTION AND IDENTIFICATION (EDI) KIT Нац. библиограф. данныеДокументыPrimeFaces.cw ... (EN) EXPLOSIVE DETECTION AND IDENTIFICATION (EDI) KIT Реферат (EN) The scientific ...
Обнаружены две новые теплые экзопланеты. Год на них длится 5 дней
Патент от
05 октября 1980 года

Заявител(и)ь: SPS TECHNOLOGIES

Изобретател(и)ь: KIBBLEWHITE I E;BOYS J T;TAMBINI A L

Номер заявки:

Дата заявки: 05.10.1980

Классификация: B25B23-1453, G01D5-24404, B25B0021020000, B25B0023145000, G01D0005244000

Дата международной регистрации:

Международные идентификаторы:

Вес (релевантность к запросу): 2666.0469


Обнаружены две новые теплые экзопланеты. Год на них длится 5 дней. TOI 122b обращается вокруг своей звезды-хозяина каждые 5,08 дней на расстоянии примерно 0,04 а.е. Система расположена примерно в 206 световых годах от нас. Находящаяся на расстоянии около 124 световых лет от Солнца TOI 237b — это планета размером с Землю.
Министерство обороны РФ: на территории Армении сбит российский вертолет
Патент от
09 мая 1977 года

Заявител(и)ь: SPS TECHNOLOGIES

Изобретател(и)ь: BOYS J T

Номер заявки:

Дата заявки: 09.05.1977

Классификация: B25B23-1456, G01N3-08, G01N3-22, G01L0005000000, B25B0023145000, F16D0043200000, G01L0005240000, G01N0003080000, G01N0003220000, G01N0003360000

Дата международной регистрации:

Международные идентификаторы:

Вес (релевантность к запросу): 2666.0469


Министерство обороны РФ: на территории Армении сбит российский вертолет. Российский вертолет был сбит на в горной местности Армении, сообщило Министерство обороны России. Атака была произведена с земли из переносного зенитного ракетного комплекса.
СПОСОБ ОПРЕДЕЛЕНИЯ ПРОЧНОСТИ СМЕРЗАНИЯ МЕРЗЛЫХ ГОРНЫХ ПОРОД С РАЗЛИЧНЫМИ МАТЕРИАЛАМИ И УСТРОЙСТВО ДЛЯ ЕГО ОСУЩЕСТВЛЕНИЯ
Патент от
20 марта 1976 года

Заявител(и)ь: SPS TECHNOLOGIES

Изобретател(и)ь: ASPERS A J;FINKELSTON R J

Номер заявки:

Дата заявки: 20.03.1976

Классификация: G05D17-02, B25B21-002, B25B23-1456, B23P0019060000, B25B0021000000, B25B0023140000, B25B0023145000, B25B0023151000, G05D0017020000

Дата международной регистрации:

Международные идентификаторы:

Вес (релевантность к запросу): 2666.0469


СПОСОБ ОПРЕДЕЛЕНИЯ ПРОЧНОСТИ СМЕРЗАНИЯ МЕРЗЛЫХ ГОРНЫХ ПОРОД С РАЗЛИЧНЫМИ МАТЕРИАЛАМИ И УСТРОЙСТВО ДЛЯ ЕГО ОСУЩЕСТВЛЕНИЯ. (RU) 1. Способ определения прочности смерзания мерзлых горных пород с различными материалами, включающий изготовление образца материала, размещение образцов материала и мерзлой горной породы в устройство для определения прочности смерзания мерзлых горных пород с различными материалами, нагружение этих образцов нормальным по отношению к плоскости смерзания давлением, испытание смороженных образцов на сдвиг, отличающийся тем, что изготовление образца горной породы талого состояния производят отдельно от образца материала, после чего осуществляют замораживание этого образца в помещении с отрицательной температурой и нагрев поверхности контакта с образцами материала тепловым потоком, смораживание же образцов материала и мерзлой горной породы производят при их нахождении в устройстве для определения прочности смерзания мерзлых горных пород с различными материалами под нормальным давлением в помещении с регулируемой температурой. 2. Устройство для определения прочности смерзания мерзлых горных пород с различными материалами, включающее боковой штамп и приспособление для передачи образцам материала и мерзлой горной породы нормального по отношению к плоскости смерзания давления, состоящее из упорной плиты, винта нагружения и динамометра со стрелочным индикатором, отличающееся тем, что оно снабжено кассетой для смораживания и испытания образцов материала и мерзлой горной породы, представленной корпусом кассеты для смораживания и испытания образцов материала и мерзлой горной породы, который жестко соединен с опорной плитой кассеты и шпильками со втулками и гайками, соединяющими опорную плиту кассеты с боковым штампом, корпусом приспособления для передачи образцам материала и мерзлой горной породы нормального по отношению к плоскости смерзания давления, стопорами упорной плиты, фиксирующими ее в этом корпусе, матрицей, включающей основание матрицы, на котором располагают ползуны матрицы, снабженные ...
ДЕМУЛЬТИПЛЕКСОР СО СПЕКТРАЛЬНЫМ РАЗДЕЛЕНИЕМ КАНАЛОВ
Патент от
09 февраля 1980 года

Заявител(и)ь: SPS TECHNOLOGIES

Изобретател(и)ь: TAMBINI A L

Номер заявки:

Дата заявки: 09.02.1980

Классификация: B25B23-14, B25B23-1425, B25B0023151000, B25B0023140000, B25B0023142000, B25B0023144000

Дата международной регистрации:

Международные идентификаторы:

Вес (релевантность к запросу): 2666.0469


ДЕМУЛЬТИПЛЕКСОР СО СПЕКТРАЛЬНЫМ РАЗДЕЛЕНИЕМ КАНАЛОВ. (EN) FIELD: optics. SUBSTANCE: invention relates to optics, namely to demultiplexers, which separates incoming signal by wavelength, and can be used, mainly, as an optical element in telecommunication systems for spectral separation of channels. In a demultiplexer with spectral division of channels, which comprises a collimating lens in series, the front surface of which receives an input signal from the optical fiber, dispersing element made of two truncated cylinders, interconnected coaxially with end surfaces, wherein demultiplexer is configured to focus output signal on group of optical fibers, wherein on one of the connected end surfaces of the truncated cylinders there is a transmitting three-dimensional holographic diffraction grating, the front end surface of the first truncated cylinder, located on the side of the secant plane, as well as connected end surface of one of truncated cylinders are made convex, and connected end surface of other cylinder and rear end surface of second truncated cylinder, located on side of secant plane, are concave. EFFECT: technical result of the invention is to increase the level of transmission of the signal by making the dispersive element in the form of a focusing-dispersing element and excluding the focusing lens. 1 cl, 5 dwg(RU) Изобретение относится к оптике, а именно к демультиплексорам, разделяющим входящий сигнал по длинам волн, и может быть использовано, преимущественно, в качестве оптического элемента в системах телекоммуникаций для спектрального разделения каналов. Техническим результатом изобретения является повышение уровня пропускания сигнала за счет выполнения диспергирующего элемента в виде фокусирующе-диспергирующего элемента и исключения фокусирующего объектива. Для этого в демультиплексоре со спектральным разделением каналов, содержащем последовательно расположенные коллимирующий объектив, фронтальная поверхность которого принимает входящий сигнал от оптоволокна, диспергирующий элемент, выполненный из ...
РЕАКТОР СО СТАЛЬНЫМ СЕРДЕЧНИКОМ
Патент от
01 октября 1977 года

Заявител(и)ь: SPS TECHNOLOGIES

Изобретател(и)ь: TAMBINI A L;WALLACE P W

Номер заявки:

Дата заявки: 01.10.1977

Классификация: B25B23-14, B25B0023151000, B25B0023140000

Дата международной регистрации:

Международные идентификаторы:

Вес (релевантность к запросу): 2666.0469


РЕАКТОР СО СТАЛЬНЫМ СЕРДЕЧНИКОМ. (RU) 1. Реактор со стальным сердечником, содержащий активную часть реактора, имеющую две или несколько отдельных активных частей, причем обмотки (8) в активных частях соединены вместе. 2. Реактор со стальным сердечником по п.1, отличающийся тем, что обмотки (8) в активных частях могут быть соединены вместе последовательно, и также могут быть соединены вместе параллельно. 3. Реактор со стальным сердечником по п.2, отличающийся тем что, когда в реакторе используются две активные части, способ последовательного соединения обмоток в этих двух активных частях может состоять в том, что один конец первой обмотки (11) в первой активной части является вводным концом, другой конец первой обмотки соединен с одним концом второй обмотки (12) во второй активной части, и другой конец второй обмотки является выводным концом, формируя, таким образом, последовательное соединение; последовательное соединение также может состоять в том, что первая обмотка (11) соединена со второй обмоткой (12) последовательно, используя вводные провода в середине обмоток, т.е. первая обмотка (11) использует вводной провод в середине первой обмотки и выводные провода на обоих концах первой обмотки, при этом выводные провода первой обмотки соединяются параллельно, чтобы создать вводной провод второй обмотки (12), во второй обмотке используется вводной провод в середине второй обмотки и выводные провода на обоих концах второй обмотки, причем выводные провода на обоих концах второй обмотки соединяются параллельно, и параллельное соединение между выводными проводами на обоих концах первой обмотки включено последовательно с вводным проводом в середине второй обмотки. 4. Реактор со стальным сердечником по п.2, отличающийся тем что, когда в реакторе используются две активные части, способ параллельного соединения обмоток в этих двух активных частях может состоять в том, что концы обмоток соединяются параллельно, т.е. один конец каждой из двух обмоток в этих двух активных частях, является вводным концом активной части и ...
Авиакомпания «РусЛайн» снижает стоимость перелета из Нарьян-Мара в Москву
Патент от
20 ноября 1976 года

Заявител(и)ь: SPS TECHNOLOGIES

Изобретател(и)ь: SIGMUND J A

Номер заявки:

Дата заявки: 20.11.1976

Классификация: B25B23-14, G05D17-02, B25B0023151000, B25B0023140000, G05D0017020000

Дата международной регистрации:

Международные идентификаторы:

Вес (релевантность к запросу): 2666.0469


Авиакомпания «РусЛайн» снижает стоимость перелета из Нарьян-Мара в Москву. Авиакомпания "РусЛайн», один из ведущих игроков на рынке региональных перевозок в России, снизила стоимость перелета по направлению Нарьян-Мар - Москва. ...read more
Сколько Вселенных в Теории струн?
Патент от
22 марта 1976 года

Заявител(и)ь: SPS TECHNOLOGIES

Изобретател(и)ь: HARDIMAN R J;SMITH S K

Номер заявки:

Дата заявки: 22.03.1976

Классификация: B25B23-1456, Y10T29-53687, B25B0023151000, B25B0023140000, B25B0023145000

Дата международной регистрации:

Международные идентификаторы:

Вес (релевантность к запросу): 2666.0469


Сколько Вселенных в Теории струн?. Основная проблема теории струн по мнению некоторых учёных заключается в слишком большом количестве производных Вселенных. Теория струн предсказывает не одну, а 10 (в 500 степени) версий существования пространства-времени, и каждая из этих Вселенных обладает собственными законами физики. Но если существует такое большое количество Вселенных, как…
Поверхность Европы по ночам светится зеленым
Патент от
20 марта 1976 года

Заявител(и)ь: SPS TECHNOLOGIES

Изобретател(и)ь: WALKER R A

Номер заявки:

Дата заявки: 20.03.1976

Классификация: B25B23-1456, F16B31-028, G05D17-02, B25B0023151000, B25B0023140000, B25B0023145000, F16B0031020000, G05D0017020000

Дата международной регистрации:

Международные идентификаторы:

Вес (релевантность к запросу): 2666.0469


Поверхность Европы по ночам светится зеленым. Статья с выводами исследователей опубликовал научный журнал Nature Astronomy Ученым удалось выяснить, что поверхность Европы-спутника Юпитера, на котором предположительно может существовать жизнь, ночью светится синим и зеленым цветами.
Армия обороны Карабаха начала операцию по уничтожению азербайджанской группировки в районе Шуши
Патент от
20 ноября 1976 года

Заявител(и)ь: SPS TECHNOLOGIES

Изобретател(и)ь: BOYS J T

Номер заявки:

Дата заявки: 20.11.1976

Классификация: B25B23-1456, B23P19-066, G05D17-02, B25B0023151000, B23P0019060000, B25B0023140000, B25B0023145000, G05D0017020000

Дата международной регистрации:

Международные идентификаторы:

Вес (релевантность к запросу): 2666.0469


Армия обороны Карабаха начала операцию по уничтожению азербайджанской группировки в районе Шуши. Армия обороны Карабаха близ Шуши приступила к проведению операции по ликвидации еще одной группировки ВС Азербайджана, которая пытается прорваться в стратегически важный город. Об этом сегодня
СИСТЕМА С ПЕРЕДАТОЧНОЙ ФУНКЦИЕЙ ДЛЯ ОПРЕДЕЛЕНИЯ ИДЕНТИФИКАТОРА НА ИДЕНТИФИКАЦИОННОЙ ПАВ-МЕТКЕ И СПОСОБ ЕЕ ФУНКЦИОНИРОВАНИЯ
Патент от
20 ноября 1976 года

Заявител(и)ь: SPS TECHNOLOGIES

Изобретател(и)ь: BOYS J T;WALLACE P W

Номер заявки:

Дата заявки: 20.11.1976

Классификация: G05D17-02, B25B23-1456, B25B0023151000, B25B0023140000, B25B0023145000, G05D0017020000

Дата международной регистрации:

Международные идентификаторы:

Вес (релевантность к запросу): 2666.0469


СИСТЕМА С ПЕРЕДАТОЧНОЙ ФУНКЦИЕЙ ДЛЯ ОПРЕДЕЛЕНИЯ ИДЕНТИФИКАТОРА НА ИДЕНТИФИКАЦИОННОЙ ПАВ-МЕТКЕ И СПОСОБ ЕЕ ФУНКЦИОНИРОВАНИЯ. (RU) Система с передаточной функцией для определения идентификатора на идентификационной ПАВ-метке и способ ее работы. В одном из вариантов осуществления система предусматривает для генерации радиочастотного (РЧ) сигнала опроса преобразователь, расположенный на пьезоэлектрической подложке, для вырабатывания начального акустического импульса, который отражается от множества отражателей, размещенных в соответствии с временной и фазовой позицией на этой подложке, для выдачи ответных акустических импульсов, причем преобразователь генерирует ответный РЧ-сигнал из этих ответных акустических импульсов; и (2) определение идентификатора путем раскодирования этого ответного РЧ-сигнала на основании предварительно заданных временных, фазовых и амплитудных параметров. Также опубликовано в следующем виде AU2003275287 CA2500443 CN1689053 EP1552486 IN335/MUMNP/2005 JP2006507610 KR1020050055759 NZ539135 PH1-2005-500667 PH12005500667 US10268108 WO/2004/086322 Конвенционная заявка на патент с приоритетом от 9 октября 2002 г. на имя инофирмы ЭрЭф Со Компоненте, Инкорпорейтед, США PCT/US03/30692 СИСТЕМА С ПЕРЕДАТОЧНОЙ ФУНКЦИЕЙ ДЛЯ ОПРЕДЕЛЕНИЯ ИДЕНТИФИКАТОРА НА ИДЕНТИФИКАЦИОННОЙ ПАВ-МЕТКЕ И СПОСОБ ЕЕ ФУНКЦИОНИРОВАНИЯ Область техники Изобретение относится, в общих чертах, к системе для определения идентификатора на идентификационной метке и, более конкретно, к системе с передаточной функцией для определения идентификатора на идентификационной метке на поверхностных акустических волнах (ПАВ-метке). Предпосылки создания изобретения Для устранения недостатков, присущих известным радиочастотным идентификационным меткам (RFID-меткам) в отношении стоимости, информационной емкости и дальности надежной работы, была разработана новая технология RFID-меток. В этой новой технологии в качестве идентификационных меток используются устройства на поверхностных акустических волнах (ПАВ). Они подробно описаны в патентной заявке ...
Eta – Atlantic Ocean
Космическая новость зарубежных СМИ
05 ноября 2020 года
20:20

Вес (релевантность к запросу): 2656.8647


Eta – Atlantic Ocean. NASA/JAXA GPM Satellite Eyes Eta Over Nicaragua Hurricane Eta (a Category 1) over Nicaragua on 11/4/2020 at approximately 5:25Z. This visualization focuses on the high precipitation southwest of Eta’s eye. Credit: NASA’s Scientific Visualization Studio The Global Precipitation Measurement (GPM) Core Observatory satellite flew over Hurricane Eta at 11:41 p.m. CT on Tuesday, Nov. 3 (0541 …
NASA Aids Disaster Response after Eta and Iota hit Central America
Космическая новость зарубежных СМИ
19 ноября 2020 года
19:42

Вес (релевантность к запросу): 2653.16


NASA Aids Disaster Response after Eta and Iota hit Central America. Nov. 19, 2020 – NASA Aids Disaster Response after Eta and Iota hit Central America With up to 155-mph winds, Hurricane Iota smashed record books on Nov. 16 as the strongest hurricane ever recorded to make landfall in Nicaragua. Iota reached Category 5 strength before making landfall as a Category 4 storm near the town of Haulover, …
Появилось видео вращения раскалённой материи у чёрной дыры. #RH #EHT ...
Новость не из дайджеста от
24 ноября 2020 года
13:33

Вес (релевантность к запросу): 2653.16


... материи у чёрной дыры. #RH #EHT ... Появилось видео вращения раскалённой материи ... у чёрной дыры. #RH #EHT #Телескоп #космос # ...
SpaceX is targeting Sunday, October 18 at 8:25 a.m. EDT, ...
Космическая новость зарубежных СМИ
18 октября 2020 года
13:07

Вес (релевантность к запросу): 2638.9373


SpaceX is targeting Sunday, October 18 at 8:25 a.m. EDT, ... SpaceX is targeting Sunday, October 18 at 8:25 a.m. EDT, 12:25 UTC, for its fourteenth Starlink mission, which will launch 60 Starlink satellites to orbit. Falcon 9 will lift off from Launch Complex 39A (LC-39A) at Kennedy Space Center in Florida, and a backup opportunity is available on Monday, October 19 at 8:06 a.m. EDT, 12:06 UTC. Falcon 9’s first stage previously supported Crew Dragon’s first demonstration mission to the International Space Station, launch of the RADARSAT Constellation Mission, and three Starlink missions this year. Following stage separation, SpaceX will land Falcon 9’s first stage on the “Of Course I Still Love You” droneship, which will be stationed in the Atlantic Ocean. Falcon 9’s fairing halves each previously supported two missions.
Atlas 5 takes shelter from Tropical Depression Eta
Космическая новость зарубежных СМИ
06 ноября 2020 года
23:15

Вес (релевантность к запросу): 2638.9373


Atlas 5 takes shelter from Tropical Depression Eta. Spaceflight Now: Credit: United Launch Alliance With Tropical Depression Eta forecast to restrengthen into a tropical storm and move toward Florida, United Launch Alliance moved an Atlas 5 rocket off its launch pad at Cape Canaveral Friday and delayed liftoff with a U.S. government spy satellite to Wednesday. Riding a mobile launch platform, the 206-foot-tall (63-meter) Atlas 5 rocket began rolling back into its hangar along rail tracks shortly after 4 p.m. EST (2100 GMT) Friday. A short time later, locomotives maneuvered the rocket into ULA’s Vertical Integration Facility about a third of a mile south of the launch pad. ULA said it moved the rocket back into the vertical assembly building “due to impending weather from Tropical Depression Eta.” Teams planned to secure the rocket and its payload inside the VIF as forecasters predict a chance of storms and gusty winds across Central Florida later this weekend and into next week. The next launch opportunity for the Atlas 5 rocket will be Wednesday, Nov. 11, at 5:22 p.m. EST (2222 GMT), ULA said in a brief statement Friday. A classified payload for the National Reconnaissance Office — owner of the U.S. government’s fleet of spy satellites — is mounted on top ...
Старт космического корабля «Союз МС-17»
Космическая новость зарубежных СМИ
06 октября 2020 года
09:36

Вес (релевантность к запросу): 2621.57


Старт космического корабля «Союз МС-17». Уникальное видео старта ракеты-носителя «Союз 2.1а» и космического корабля «Союз МС-17» с экипажем - командиром Сергеем Рыжиковым и бортинженерами Сергеем Кудь-Сверчковым и Кэтлин Рубинс.
Корабль "Союз МС-16" с возвращающимся на Землю экипажем покинул МКС ...
Космическая новость зарубежных СМИ
06 октября 2020 года
18:55

Вес (релевантность к запросу): 2621.57


Корабль "Союз МС-16" с возвращающимся на Землю экипажем покинул МКС ... Корабль "Союз МС-16" с возвращающимся на Землю экипажем покинул МКС Корабль "Союз МС-16" с россиянами Анатолием Иванишиным и Иваном Вагнером и американцем Кристофером Кэссиди отстыковался от Международной космической станции перед возвращением на Землю. Корабль отчалил от модуля "Поиск" российского сегмента МКС, на станции до апреля 2021 года остались россияне Сергей Рыжиков и Сергей Кудь-Сверчков и американка Кэтлин Рубинс. По информации "Роскосмоса", в 5.00 мск корабль должен включить двигатель на торможение для схода с орбиты, в 5.28 мск - разделиться на отсеки. Спускаемому аппарату с экипажем предстоит войти в земную атмосферу в 5.31 мск, в 5.40 мск намечается ввод парашюта и в 5.55 мск - приземление "Союза МС-16" в 147 километрах юго-восточнее казахстанского города Жезказган. Как сообщил накануне космонавт Юрий Гидзенко, в районе приземления экипаж "Союза МС-16" ожидает прохладная и ветреная погода. Прогнозируется температура воздуха от 2 до 5 градусов тепла и ветер до 18 метров в секунду, поэтому, по его словам, космонавтов в корабле может "поболтать" при спуске на парашюте, а сам "Союз МС-16" после посадки может немного "потащить". По данным пресс-службы Центрального военного округа, к обеспечению безопасности посадки корабля в основном и запасном районах близ городов Жезказган и Аркалык привлечены около 200 специалистов-спасателей, 12 вертолетов Ми-8, два самолета Ан-26 и два Ан-12 и более 20 единиц наземной автомобильной техники, в том числе шесть модернизированных поисково-эвакуационных машин ПЭМ-1 и ПЭМ-2 "Синяя птица". В ходе 196-суточной экспедиции на борту МКС экипаж принял два российских грузовых корабля "Прогресс", японский HTV-9 и американский Cygnus. Впервые с 2011 года на станцию прибыл американский корабль с экипажем - Crew Dragon компании SpaceX Илона Маска. Было осуществлено четыре американских выхода в открытый космос, а МКС дважды уклонялась от столкновения с космическим мусором. В полете фиксировалась повышенная ...
Fuktupptagande skoinlägg av engångstyp
Патент от
28 декабря 2018 года

Заявител(и)ь: BERGMAN KARIN

Изобретател(и)ь: BERGMAN KARIN

Номер заявки:

Дата заявки: 28.12.2018

Классификация: A43B17-00, A43B17-08, A43B17-105, A43B0017080000, A43B0017000000, A43B0017100000

Дата международной регистрации:

Международные идентификаторы:

Вес (релевантность к запросу): 1741.6045


... tjock, platta innefattande ett absorberande huvudskikt (10) och ett på plattans undersida anbringat ... skoinlägg innefattar ett hälparti (4) och ett framfotsparti (2) förbundna genom ett mellanfotsparti (3). Mellan ... å väsentligen identiskt formade delar, varigenom ett enstaka skoinlägg kan utnyttjas ... tjock, platta innefattande ett absorberande huvudskikt och ett på plattans undersida anbringat adhesiv ... . Skoinlägget innefattar ett hälparti och ett framfotsparti förbundna genom ett mellanfotsparti. Mellanfotspartiet ... sentligen identiskt formade delar, varigenom ett enstaka skoinlägg kan utnyttjas ... miljö användaren befinner sig. I ett utförande är anvisningen genom mellanfotspartiet ... detta utförande är att mellanskiktet i ett flerskiktat skoinlägg hålls på plats ... gget delas i den perforerade linjen. I ett utförande är skoinläggets huvudskikt ... , särskilt papper, pappersfibrer eller pappersmassa. I ett utförande uppbär åtminstone endera ... natur- eller konstfiber på huvudskiktet. I ett utförande är en nålperforering utf ... rd i skoinläggets ovansida, till ett djup som åtminstone överskrider tjockleken ... hos ett ytskikt. På detta sätt bildas mikroporer ... med atmosfären ovanför ett ytskikt. I ett utförande uppvisar skoinläggets ... Detta utförande är särskilt lämpligt i ett skoinlägg avsett för fysiskt aktiv ... . 1-2, och kan därvid innefatta ett framfotsparti 2, ett mellanfotsparti 3 och ett hälparti 4. Åtminstone en ... ägget såsom visas i Fig. 2 innefatta ett med ett adhesiv belagt fält 9. Adhesivf ... 10 består företrädesvis av ett naturmaterial, varvid särskilt föredraget är bomull ... öranden är begränsade till naturmaterial. I ett sammansatt, flerskiktat skoinlägg kan ... tjock, platta innefattande ett absorberande huvudskikt (10) och ett på plattans undersida anbringat ... skoinlägg innefattar ett hälparti (4) och ett framfotsparti (2) förbundna genom ett mellanfotsparti (3), vari ... sentligen identiskt formade delar, varigenom ett enstaka skoinlägg kan utnyttjas ...
Экипаж МКС заделывает трещину в российском модуле
Патент от
17 июля 2008 года

Заявител(и)ь: Lockheed Martin Corporation

Изобретател(и)ь: Gounalis Anthony J.

Номер заявки:

Дата заявки: 17.07.2008

Классификация: G01S0007020000, G01S0007420000

Дата международной регистрации:

Международные идентификаторы:

Вес (релевантность к запросу): 1737.7408


Экипаж МКС заделывает трещину в российском модуле. Экипаж Международной космической станции (МКС) заделывает заплаткой из резины и алюминиевой фольги трещину в российском модуле "Звезда", ставшую причиной утечки воздуха, следует из переговоров космонавтов с Землей, транслируемых НАСА.
GENETICALLY OPTIMISED MICROORGANISM FOR PRODUCING MOLECULES OF INTEREST
Патент от
02 августа 2018 года

Заявител(и)ь: ENOBRAQ

Изобретател(и)ь: BOISART, Cédric;MORIN, Nicolas

Номер заявки:

Дата заявки:

Классификация: C12N15-52, C12N9-0006, C12N9-0008, C12N9-1205, C12N9-1217, C12N9-18, C12N9-88, C12P13-001, C12P13-14, C12P7-42, C12P7-62, C12P7-625, C12Y101-01044, C12Y101-01049, C12Y102-01012, C12Y207-01019, C12Y207-02003, C12Y301-01031, C12Y401-01039, C12N0001130000, C12N0001150000, C12N0001190000, C12N0001210000, C12N0015520000, C12N0009880000, C12N0009120000, C12N0009040000, C12N0009020000, C12N0009180000

Дата международной регистрации: 26.01.2018

Международные идентификаторы: WO/2018/138289, PCT/EP2018/052005

Вес (релевантность к запросу): 1735.9235


... enzymes : (i) la 6-phosphogluconate déshydratase (« EDD » - EC. 4.2.1.12), et (ii) la ... 2-déshydro-3-désoxy-phosphogluconate aldolase (« EDA » - E.C. 4.1.2.14). La 6-phosphogluconate déshydratase ... 6-phosphogluconate déshydratase peuvent s'appeler edd (GenBank NP_416365, par exemple, chez ... ésoxy-phosphogluconate aldolase peuvent s'appeler eda (GenBank NP_416364, par exemple, chez ... de séquences codant pour une EDD Tableau 10 : Exemples de séquences ... codant pour une EDA D'une manière générale, dans ... dans laquelle l'expression du gène edd est au moins partiellement inhib ... l'expression des gènes gapA, et edd soient au moins partiellement inhib ... AsucA b) Délétion de Vopéron edd-eda codant la voie métabolique d'Entner ... La délétion de l'opéron edd-eda est réalisée par recombinaison homologue ... EQ.EC003 : MG1655 AsucA Aedd-eda c) Délétion du gène gapA La ... .EC003 : MG\655 AsucA Aedd-eda • EQ.EC004 : MG1655 AsucA Aedd ... -eda AgapA::kan d) Insertion de l'ingé ... + pZAl l) : MG1655 AsucA Aedd-eda EQ.EC 006 ·* (EQ.EC ... + pEQEC005) : MG1655 AsucA Aedd-eda A gapA ::kan (RuBisCO) EQ.EC ... + pEQECOOô) : MG1655 AsucA Aedd-eda A gapA ::kan (RuBisCO+PRK) EQ ... + pEQEC008) : MG1655 AsucA Aedd-eda AgapA ::kan (PRK) Les clones ... adjacentes des gènes edd et eda (en amont de edd et en aval ... de eda) sont clonées par ... plasmide modifié pJQ200mpl 8Cm::Aedd-eda est alors transformé dans une ... voie métabolique d'Entner-Doudoroff edd-eda. EQCN_002 : H16 Aedd-eda. b) Inactivation de la ... gène gapA. EQCN_003 : H16 Aedd-eda AgapA. La souche EQCN_003, délétée dans ... Doudoroff au niveau des gènes edd-eda est cultivée afin d' améliorer ... la souche EQCN_003 : H16 Aedd-eda AgapA, on constate une augmentation ...
GENETICALLY OPTIMISED MICROORGANISM FOR PRODUCING MOLECULES OF INTEREST
Патент от
02 августа 2018 года

Заявител(и)ь: ENOBRAQ

Изобретател(и)ь: BOISART, Cédric;MORIN, Nicolas

Номер заявки:

Дата заявки:

Классификация: C12N15-52, C12N9-1022, C12N9-1205, C12N9-88, C12P13-14, C12P5-026, C12P7-625, C12Y202-01001, C12Y202-01002, C12Y207-01019, C12Y401-01039, C12N0001130000, C12N0001150000, C12N0001190000, C12N0001210000, C12N0015520000, C12N0009880000, C12N0009120000, C12N0009040000, C12N0009020000, C12N0009180000, C12N0009100000

Дата международной регистрации: 26.01.2018

Международные идентификаторы: WO/2018/138288, PCT/EP2018/052004

Вес (релевантность к запросу): 1734.628


... enzymes : (i) la 6-phosphogluconate déshydratase (« EDD » - EC. 4.2.1.12), et (ii) la ... 2-déshydro-3-désoxy-phosphogluconate aldolase (« EDA » - E.C. 4.1.2.14). La 6-phosphogluconate déshydratase ... 6-phosphogluconate déshydratase peuvent s'appeler edd (GenBank NP_416365, par exemple, chez ... ésoxy-phosphogluconate aldolase peuvent s'appeler eda (GenBank NP_416364, par exemple, chez ... codant pour une EDD Gène GenBank Gl Organisme edd N P_416365.1 16129804 Escherichia ... CN D70554.1 893638835 Mycobacterium tuberculosis edd AJQ65426.1 764046652 Salmonella enterica Tableau ... de séquences codant pour une EDA D'une manière générale, dans ... dans laquelle l'expression du gène edd est au moins partiellement inhib ... l'expression des gènes talA, et edd soient au moins partiellement inhib ... AsucA b) Délétion de l'opéron edd-eda, codant pour la voie métabolique ... La délétion de l'opéron edd-eda est réalisée par recombinaison homologue ... EQ.EC003 : MG1655 AsucA Aedd-eda c) Délétion du gène talA La ... • EQ.EC003 : MG1655 AsucA Aedd-eda • EQ.EC020 : MG1655 AsucA Aedd ... + pZAl l) : MG1655 AsucA Aedd-eda EQ.EC 021 (EQ.EC ... + pEQEC005) : MG1655 AsucA Aedd-eda -talAr.kan (RuBisCO) EQ ... + pEQEC006) : MG1655 AsucA Aedd-eda talAr. kan (RuBisCO+PRK) EQ ... + pEQEC008) : MG1655 AsucA Aedd-eda AtalArkan (PRK) Les clones sont ... des gènes edd et eda (en amont d'edd et en aval d'eda) sont clon ... . Le plasmide modifié pJQ200mpl8Cm::Aedd-eda est alors transformé dans une ... tal. EQCN_011 : H16 Atal Aedd-eda c) Production de PHB en bior ... souche EQCN_011 : H16 Atal Aedd-eda, respectivement, montre une augmentation de ...
ANTIBIOTIC-FREE PLASMID
Патент от
25 ноября 2010 года

Заявител(и)ь: MERIAL LIMITED;AUDONNET, Jean-Christophe;JOLIVET, Edmond

Изобретател(и)ь: AUDONNET, Jean-Christophe;JOLIVET, Edmond

Номер заявки:

Дата заявки:

Классификация: A61P31-04, C12N15-635, C12N15-73, C12N15-85, C12N2800-107, C12N2800-24, C12P21-00, C12N0015730000, C12N0015630000, C12N0015680000

Дата международной регистрации: 24.05.2010

Международные идентификаторы: WO/2010/135742, PCT/US2010/035979

Вес (релевантность к запросу): 1733.832


... inserted by allelic replacement of edA or purN gene, respectively, into ... the allelic replacement of the edA gene into the ApurN 'Ω λPr ... engineering, namely the deletion of edA and purN in E. coli. FIG ... by allelic replacement of either edA and/or purN gene(s). Figure ... , namely the deletions of both edA and purN in E. coli by ... by allelic replacement of either edA or purN gene. These genes ... inserted by allelic replacement of edA or purN gene, respectively, into ... by allelic replacement of the edA ox purN gene. This cassette ... inserted by allelic replacement of edA gene into the Prλ::sacB ... targeting the deletion of the edA gene by allelic exchange was ... by allelic replacement of the edA or purN gene. The transformed ... and PB 1233 primers for edA deletion. PB1234 (SEQ ID NO ... . The 5' flanking region of the edA gene was amplified with the ... . The 3' flanking region of the edA gene was amplified with the ... and PB 1238 primers for edA (allelic replacement). The PCR condition ... and 3407 bp for the edA allelic replacement) were checked on ... sequences bordering the target locus {edA or purN) was integrated into ... (ApurN λPrr.sacB Ω.kan or ΔedA λPrr.sacB Ω.kan single mutant ... .sacB Ω.kan cassette insertion at edA or purN locus was verified ... to verify the absence of edA gene) (see FIG 9B). The ... of the cassette at the edA locus. The PCR using the ... of the cassette at the edA locus. The PCR using PB ... sequences bordering the target locus (edA) was integrated into the chromosome ... candidates (ApurN λPrr.sacB Ω.kan ΔedA λPrr.sacB Ω.cat double mutant ... Ω.cat cassette insertion at the edA locus was verified by PCR ...
A novel complex comprising a cell penetrating peptide, a cargo and a TRL peptide agonist
Патент от
10 августа 2017 года

Заявител(и)ь: Amal Therapeutics SA

Изобретател(и)ь:

Номер заявки:

Дата заявки: 10.08.2017

Классификация: A61K39-0011, A61K39-385, A61K2039-6031, C07K14-70514, C07K14-70517, C07K2319-10, C07K2319-40, A61K38-10, A61K38-17, A61K38-177, A61P1-00, A61P35-00, C12N2710-16233, Y02A50-30, A61K47-42, A61K47-6425, A61K47-6811, A61K47-6865, A61K2039-5154, C07K2319-02, C07K2319-03, C07K2319-33, A61K38-1764, A61K47-64, A61K47-6803, A61K0039000000

Дата международной регистрации:

Международные идентификаторы:

Вес (релевантность к запросу): 1732.3806


... ; URL: http://cvc.dfci.harvard.edu/tadb/). Examples of cancer/tumor ... ; URL: http://cvc.dfci.harvard.edu/tadb/). EpCAM Ep-Cam is ... ; URL: http://cvc.dfci.harvard.edu/tadb/). Mucin-1 (MUC-1 ... ; URL: http://cvc.dfci.harvard.edu/tadb/). Gp100 Glycoprotein 100, gpl ... ; URL: http://cvc.dfci.harvard.edu/tadb/). hTert Telomerase reverse transcriptase ... ; URL: http://cvc.dfci.harvard.edu/tadb/). TRP-2 Tyrosinase related ... ; URL: http://cvc.dfci.harvard.edu/tadb/). YKL-40 YKL-40 ... ; URL: http://cvc.dfci.harvard.edu/tadb/). Brevican Brevican core protein ... ; URL: http://cvc.dfci.harvard.edu/tadb/). Neuroligin 4 Neuroligin (NLGN), a type ... ; URL: http://cvc.dfci.harvard.edu/tadb/). PTPRz1 Receptor-type tyrosine ... ; URL: http://cvc.dfci.harvard.edu/tadb/). Preferably, the complex according ... ; URL: http://cvc.dfci.harvard.edu/tadb/). A ,,sequence variant" is as ... isoforms is the extra domain A (EDA), which interacts with TLR4. Further ... TLR peptide agonists comprise a fibronectin EDA domain or a fragment or variant ... thereof. Such suitable fibronectin EDA domains or a fragments or variants ... NO: 45 (TLR4 peptide agonist EDA) In addition, high-mobility group ... Mad5 and MPLA (equimolar to EDA). Mice were bled 7 days after ... with Mad5 and MPLA (equimolarto EDA). Mice were bled 7 days after ... Mad5 and MPLA (equimolar to EDA). Mice were bled 7 days after ... Mad5 and MPLA (equimolar to EDA) s.c. in the right flank. Tumor ... Mad5 and MPLA (equimolar to EDA) s.c. in the right flank. Tumor ... EDAZ13Mad5, Z13Mad5 + MPLA (equimolar to EDA) or MPLA alone s.c. in the ...
Российские миротворцы полностью разминировали Лачинский коридор и открыли движение по дороге до Степанакерта
Патент от
27 ноября 1997 года

Заявител(и)ь: LOCKHEED MARTIN ENERGY SYSTEMS, INC.

Изобретател(и)ь: MIRZADEH, Saed;KNAPP, Furn, F., Jr.;COLLINS, Emory, D.

Номер заявки:

Дата заявки:

Классификация: A61K51-1282, G21G2001-0036, A61K0051120000

Дата международной регистрации: 12.12.1996

Международные идентификаторы: WO/1997/044110, PCT/US1996/020506

Вес (релевантность к запросу): 1731.8098


Российские миротворцы полностью разминировали Лачинский коридор и открыли движение по дороге до Степанакерта. Российские миротворцы полностью разминировали Лачинский коридор. По участку дороги до Степанакерта уже открыли движение транспорта. Об этом на брифинге сообщил официальный представитель Минобороны России генерал-майор Игорь Конашенков. «Инженерными подразделениями российского миротворческого контингента полностью разминирован и очищен от взрывоопасных предметов, разбитой и поврежденной техники Лачинский коридор и участок дороги до Степанакерта протяженностью 28 километров. С 10.00 сегодняшнего дня по нему открыто безопасное движение гражданского автотранспорта», - сказал он. По словам Конашенкова, в соответствии с указом президента на территории Нагорного Карабаха продолжается развертывание российского контингента миротворческих сил. В районах проведения операции осуществляется круглосуточный мониторинг обстановки и контроль за соблюдением режима прекращения огня. Наблюдение ведут миротворческие подразделения на 25 постах. «В Степанакерте развернут штаб российского контингента миротворческих сил, с командного пункта которого осуществляется управление миротворческой операцией. Режим прекращения огня соблюдается по всей линии соприкосновения», - подчеркнул официальный представитель МО РФ. С 16 ноября в Нагорный Карабах с территории Армении вернулись 482 беженца. С 14 ноября в Степанакерт уже вернулись 1 207 жителей, ранее покинувших свои дома в Нагорном Карабахе из-за боевых действий. «Безопасность передвижения колонн обеспечивали патрули российского миротворческого контингента и военной полиции», - сказал Конашенков. Также в соответствии с достигнутыми договоренностями в Карабахе продолжается обмен телами погибших. Он проводится при координации миротворческих сил РФ и Международного комитета Красного Креста. «Продолжается переброска личного состава, военной техники и материального имущества миротворческого контингента самолетами военно-транспортной авиации России Ил-76, Ан-124. Всего с 10 ноября 2020 года ...
A NOVEL COMPLEX COMPRISING A CELL PENETRATING PEPTIDE, A CARGO AND A TLR PEPTIDE AGONIST
Патент от
22 сентября 2016 года

Заявител(и)ь: AMAL THERAPEUTICS SA

Изобретател(и)ь:

Номер заявки:

Дата заявки: 22.09.2016

Классификация: A61K39-0011, A61K39-385, A61K2039-6031, C07K14-70514, C07K14-70517, C07K2319-10, C07K2319-40, A61K38-10, A61K38-17, A61K38-177, A61P1-00, A61P35-00, C12N2710-16233, Y02A50-30, A61K47-42, A61K47-6425, A61K47-6811, A61K47-6865, A61K2039-5154, C07K2319-02, C07K2319-03, C07K2319-33, A61K38-1764, A61K47-64, A61K47-6803, A61K0039000000

Дата международной регистрации:

Международные идентификаторы:

Вес (релевантность к запросу): 1731.1848


... ; URL: http://cvc.dfki.harvard.edu/tadb/). Examples of cancer/tumor ... ; URL: http://cvc.dfki.harvard.edu/tadb/). EpCAM [p-Cam is ... ; URL: http://cvc.dfki.harvard.edu/tadb/). 15 Mucin-1 (MUC ... FVDEYDPTI EDSYRKQVVIDGETCLLDILDTAGQEEY SAMRDQYMRTGEG FLCVFAI N NKSF EDI H HYREQIKRVKDSEDVPMVLVGN KCL PSRTVD TKQAQDLARSYGI PFI ... ; URL: http://cvc.dfki.harvard.edu/tadb/). Glycoprotein 100, gp100 or ... ; URL: http://cvc.dfki.harvard.edu/tadb/). hTert Telomerase reverse transcriptase ... ; URL: http://cvc.dfki.harvard.edu/tadb/). TRP-2 25 Tyrosinase ... ; URL: http://cvc.dfki.harvard.edu/tadb/). YKL-40 YKL-40 ... ; URL: http://cvc.dfki.harvard.edu/tadb/). Brevican Brevican core protein ... ; URL: http://cvc.dfki.harvard.edu/tadb/). Neuroligin 4 Neuroligin (NLGN), a type ... ; URL: http://cvc.dfki.harvard.edu/tadb/). PTPRZ1 Receptor-type tyrosine ... ; URL: http://cvc.dfki.harvard.edu/tadb/). Preferably, the complex according ... ; URL: http://cvc.dfki.harvard.edu/tadb/). A sequence variant" is as ... isoforms is the extra domain A (EDA), which interacts with TLR4. Further ... TLR peptide agonists comprise a fibronectin EDA domain or a fragment or variant ... thereof. Such suitable fibronectin EDA domains or a fragments or variants ... NO: 45 (TLR4 peptide agonist EDA) In addition, high-mobility group ... Made and MPLA (equimolar to EDA). Mice were bled 7 days after ... Made and MPLA (equimolar to EDA). Mice were bled 7 days after ... Made and MPLA (equimolar to EDA). Mice were bled 7 days after ...
A NOVEL COMPLEX COMPRISING A CELL PENETRATING PEPTIDE, A CARGO AND A TLR PEPTIDE AGONIST
Патент от
01 декабря 2017 года

Заявител(и)ь: AMAL THERAPEUTICS SA

Изобретател(и)ь: DEROUAZI MADIHA;BELNOUE ELODIE

Номер заявки:

Дата заявки: 01.12.2017

Классификация: A61K39-0011, A61K39-385, A61K2039-6031, C07K14-70514, C07K14-70517, C07K2319-10, C07K2319-40, A61K38-10, A61K38-17, A61K38-177, A61P1-00, A61P35-00, C12N2710-16233, Y02A50-30, A61K47-42, A61K47-6425, A61K47-6811, A61K47-6865, A61K2039-5154, C07K2319-02, C07K2319-03, C07K2319-33, A61K38-1764, A61K47-64, A61K47-6803, C07K0019000000, C12N0015620000, C12N0005100000, A61K0039385000, A61K0039000000, A61P0035000000

Дата международной регистрации:

Международные идентификаторы:

Вес (релевантность к запросу): 1730.4982


... http://cvc.dfci.harvard.edu/tadb/)。癌症/肿瘤表位的实例包括例如TRP2-来源的表位、糖蛋白100(gp100 ... 癌症研究所癌症疫苗中心的生物信息核心实验室研发;URL:http://cvc.dfci.harvard.edu/tadb/)。 document.write("        "); 优选地,根据本发明的复合物包括至少一种肿瘤表位,其是选自如下的抗原的表位:EpCAM ... URL:http://cvc.dfci.harvard.edu/tadb/)。 document.write("        "); “序列变体”如上面限定,即序列变体具有与参考序列至少70 ... )和(ii)纤连蛋白来源的肽。细胞糖蛋白纤连蛋白(FN)具有通过三个外显子的可变剪接从单基因生成的多种同种型。这些同种型中的一种是与TLR4相互作用的额外结构域A(EDA)。 document.write("        "); 进一步合适的TLR肽激动剂包括纤连蛋白EDA结构域或其片段或变体。这样的合适的纤连蛋白EDA结构域或其片段或变体在EP 1 913 954 ... 或EDAZ13Mad5被接种疫苗两次(Wk0和Wk2)。阳性对照组使用Mad5和MPLA(与EDA等摩尔)进行接种疫苗。小鼠在最后一次接种疫苗后7天被抽血并且进行五聚体染色(3-4只小鼠/组,一个实验)。 document.write("        "); 图7:针对实施例3显示了10nmol组的结果。C57BL ... 或EDAZ13Mad5被接种疫苗两次(Wk0和Wk2)。阳性对照组使用Mad5和MPLA(与EDA等摩尔)进行接种疫苗。小鼠在最后一次接种疫苗后7天被抽血并且进行五聚体染色(3-4只小鼠/组,一个实验)。 document.write("        "); 图8:针对实施例3显示了测试的所有组的五聚体阳性CD8+T ... 或EDAZ13Mad5被接种疫苗两次(Wk0和Wk2)。阳性对照组使用Mad5和MPLA(与EDA等摩尔)进行接种疫苗。小鼠在最后一次接种疫苗后7天被抽血并且进行五聚体染色(一个实验,其中3-4只小鼠/组)。 document.write("        "); 图9:针对实施例4显示了7只小鼠/组的肿瘤生长(平均值±SEM);*,p 权利要求书 document ...
A Novel Complex Comprising A Cell Penetrating Peptide, A Cargo And A TLR Peptide Agonist
Патент от
17 мая 2018 года

Заявител(и)ь: AMAL THERAPEUTICS SA

Изобретател(и)ь: Madiha DEROUAZI;Elodie BELNOUE

Номер заявки:

Дата заявки: 17.05.2018

Классификация: A61K2039-6031, A61K38-1764, A61K38-177, A61K39-0011, A61P35-00, C07K2319-10, C07K2319-40, C12N2710-16233, A61K0039000000, A61K0038170000, A61P0035000000

Дата международной регистрации:

Международные идентификаторы:

Вес (релевантность к запросу): 1730.4982


... ; URL: http://cvc.dfci.harvard.edu/tadb/). Examples of cancer/tumor ... ; URL: http://cvc.dfci.harvard.edu/tadb/). EpCAM Ep-Cam is ... ; URL: http://cvc.dfci.harvard.edu/tadb/). Mucin-1 (MUC-1 ... ; URL: http://cvc.dfci.harvard.edu/tadb/). Gp100 Glycoprotein 100, gp100 ... ; URL: http://cvc.dfci.harvard.edu/tadb/). hTert Telomerase reverse transcriptase ... ; URL: http://cvc.dfci.harvard.edu/tadb/). TRP-2 Tyrosinase related ... ; URL: http://cvc.dfci.harvard.edu/tadb/). YKL-40 YKL-40 ... ; URL: http://cvc.dfci.harvard.edu/tadb/). Brevican Brevican core protein ... ; URL: http://cvc.dfci.harvard.edu/tadb/). Neuroligin 4 Neuroligin (NLGN), a type ... ; URL: http://cvc.dfci.harvard.edu/tadb/). PTPRz1 Receptor-type tyrosine ... ; URL: http://cvc.dfci.harvard.edu/tadb/). Preferably, the complex according ... ; URL: http://cvc.dfci.harvard.edu/tadb/). A “sequence variant” is as ... isoforms is the extra domain A (EDA), which interacts with TLR4. Further ... TLR peptide agonists comprise a fibronectin EDA domain or a fragment or variant ... thereof. Such suitable fibronectin EDA domains or a fragments or variants ... -US-00027] (TLR4 peptide agonist EDA) SEQ ID NO: 45 NIDRPKGLAFTDVDVDSIKIAWESPQGQVSRYRVTYSSPED ... Mad5 and MPLA (equimolar to EDA). Mice were bled 7 days after ... Mad5 and MPLA (equimolar to EDA). Mice were bled 7 days after ... Mad5 and MPLA (equimolar to EDA). Mice were bled 7 days after ...
«Идиопатическая артериальная гипотензия у молодых женщин: клинические и патогенетические особенности функционирования сердечно-сосудистой системы»
Автореферат диссертации от
22 ноября 2020 года
17:48

Вес (релевантность к запросу): 1728.8984


... , мм PWs, мм ESD, мм EDD, мм EDD /рост, мм/м ESV, мл ... - конечно-систолический диаметр левого желудочка; EDD - конечно-диастолический диаметр левого желудочка ... ; EDD /рост - отношение конечно-диастолического диаметра ... нагрузки 42,6 36,7 45,7 40,5 EDD, мм 0,001 0,001 (39,3- ... ,9) VЕ/VА 2,5(2,0-3,3) 1,6(1,4-2,4) 0,001 2,5(2,3-2,9) 1,6(1,4-2,2) 0,001 Примечание: EDD – конечно-диастолический диаметр левого желудочка ... ,4 43,0 0,53 44,9 46,6 0,55 EDD, мм (38,78-6,2) (38 ... ,9) VЕ/VА 2,5(2,0-3,3) 2,9(2,4-3,6) 0,002 2,4(2,1-2,9) 2,6(2,2-3,1) 0,27 Примечание: EDD – конечно-диастолический диаметр левого желудочка ... нагрузки 44,0 38,1 45,7 40,5 EDD, мм 0,001 0,001 (39,9- ... /c 2,5 1,7 2,4 1,6 0,001 0,001 VЕ/VА (2,1-3,1) (1,4-2,4) (2,1-2,9) (1,4-2,2) Примечание: EDD – конечно-диастолический диаметр левого желудочка ... 46,2 42,5 0,009 45,8 44,6 EDD, мм (42,6-49,5) (40 ... 0,42 0,59 0,37 0,53 Примечание: EDD – конечно-диастолический диаметр левого желудочка ... (Q25-Q75) Ме (Q25-Q75) EDD, мм ESD, мм VE, см ... 0,28 0,17 0,01 0,01 Примечание: EDD – конечно-диастолический диаметр левого желудочка ... (Q25-Q75) Ме (Q25-Q75) EDD, мм ESD, мм VE, см ... 0,42 0,08 0,79 0,33 Примечание: EDD – конечно-диастолический диаметр левого желудочка ... Pg-ТК - максимальный градиент давления EDD - конечно-диастолический диаметр между правым ...
PREPARATION OF ELECTRODES ON CFRP COMPOSITES WITH LOW CONTACT RESISTANCE COMPRISING LASER-BASED SURFACE PRE-TREATMENT
Патент от
29 декабря 2016 года

Заявител(и)ь: KING ABDULLAH UNIVERSITY OF SCIENCE AND TECHNOLOGY;SAUDI ARABIAN OIL COMPANY

Изобретател(и)ь: ALMUHAMMADI, Khaled Hamdan;LUBINEAU, Gilles Henn Fernard;ALFANO, Marco Francesco;BUTTNER, Ulrich

Номер заявки:

Дата заявки:

Классификация: B23K26-20, B23K26-352, B23K26-60, G01N1-44, G01N2001-045, G01N21-65, G01N27-026, G01N27-041, G01N0001440000, G01N0027020000, B23K0026000000, B23K0026600000, G01N0027040000

Дата международной регистрации: 24.06.2016

Международные идентификаторы: WO/2016/207852, PCT/IB2016/053781

Вес (релевантность к запросу): 1725.7095


... example of electrical impedance tomography (EIT) for composite characterization, in accordance ... CFRP composites. Electrical impedance tomography (EIT) can be non-invasive and ... , acoustic emission, and modal analysis, EIT does not need highly sensitive ... the main components of an EIT system is the electrode array ... intervention. Here, electrodes used for EIT of composite laminates can be ... of high-quality electrodes for EIT. In particular, suitable laser processing ... contact resistance. A short review of EIT and electrical monitoring of CFRP ... (EIS) and electrical impedance tomography (EIT). The electrical resistance change in ... EIS. [0032] Electrical impedance tomography (EIT) is a computed tomographic technique that ... collection in electrical impedance tomography (EIT). EIT is a low-cost, non-invasive ... . [0033] In ERCM, EIS and EIT, voltage-current data are used ... composite materials in ERCM, EIS, EIT or any other resistance (or ... are a key component of any EIT system and as such they ...
Основания гражданско-правовой ответственности единоличного исполнительного органа хозяйственного общества в России и государствах англо-американского права
Автореферат диссертации от
16 ноября 2020 года
02:37

Вес (релевантность к запросу): 1724.347


... III. URL: http://www8.austlii.edu.au/cgibin/viewdb/au/legis ... 1966. URL: http://www8.austlii.edu.au/cgi-bin/viewdoc/au ... . URL: http://www.law.harvard.edu/programs/olin_center/papers/pdf/323 ... . URL: http://digitalcommons.wcl.american.edu/cgi/viewcontent.cgi?article=1650 ... . URL: http://via.library.depaul.edu/cgi/viewcontent.cgi?article=1159 ... ] // URL: https://h2o.law.harvard.edu/collages/4308 (дата обращения: 17 ... у 482 http://ir.lawnet.fordham.edu/cgi/viewcontent.cgi?article=1051 ... ]. - Режим доступа: http://www8.austlii.edu.au/cgi-bin/viewdoc/au ... ]. - Режим доступа: http://www8.austlii.edu.au/cgibin/viewdb/au/legis ... доступа: https://h2o.law.harvard.edu/collages/4308 (дата обращения: 17 ... : 223 http://www.law.harvard.edu/programs/olin_center/papers/pdf/323 ... доступа: http://via.library.depaul.edu/cgi/viewcontent.cgi?article=1159 ... доступа: http://digitalcommons.wcl.american.edu/cgi/viewcontent.cgi?article=1650 ...
Method and system for displaying nowcasts along a route on a map
Патент от
18 декабря 2014 года

Заявител(и)ь: SKY MOTION RESEARCH INC.;Sky Motion Research ULC

Изобретател(и)ь: André Leblanc

Номер заявки:

Дата заявки: 18.12.2014

Классификация: G01C21-3676, G01C21-3691, G08G1-096811, G08G1-096844, G01C0021360000, G08G0001096800

Дата международной регистрации:

Международные идентификаторы:

Вес (релевантность к запросу): 1722.7782


... an estimated time of arrival (ETA) associated with the point; obtaining ... at the point at the ETA; combining the plurality of precipitation ... at the point at the ETA; and displaying, on a display device ... route based on an updated ETA associated with the updated point ... an estimated time of arrival (ETA) associated with the point; obtain ... at the point at the ETA; combine the plurality of precipitation ... at the point at the ETA; and display, on the display ... an estimated time of arrival (ETA) associated with the point; obtain ... at the point at the ETA; combine the plurality of precipitation ... at the point at the ETA; and display, on the display ... route based on an updated ETA associated with the updated point ... claim 1, further comprising determining the ETA based on traffic information. 17 ...
IMMUNE CELLS EXPRESSING A CHIMERIC ANTIGEN RECEPTOR
Патент от
18 июля 2019 года

Заявител(и)ь: THE GENERAL HOSPITAL CORPORATION

Изобретател(и)ь: MAUS, Marcela V.;CHOI, Bryan

Номер заявки:

Дата заявки:

Классификация: A61K2039-5156, A61K2039-5158, A61K2039-585, A61K2039-804, A61K35-17, A61K38-00, A61K39-0011, C07K14-7051, C07K14-70517, C07K14-70521, C07K14-70575, C07K14-70578, C07K16-2878, C07K2319-02, C07K2319-03, C07K2319-33, C07K2319-735, C07K2319-74, C07K0014000000, C07K0014475000, C07K0014525000, C07K0014725000

Дата международной регистрации: 10.01.2019

Международные идентификаторы: WO/2019/140127, PCT/US2019/013103

Вес (релевантность к запросу): 1722.7782


... -4, GITR ligand, TL1 A, or EDA-A2. Accordingly, one aspect of ... signaling domain of CD3zeta, CD3 eta, or CD3 theta. In one ... (GITR) ligand, or ectodysplasin A2 (EDA-A2). In some embodiments, the ... ) ligand, TL1 A, or ectodysplasin A2 (EDA-A2). In some embodiments, the ... -4, GITR ligand, TL1 A, or EDA-A2. Furthermore, the invention described ... (GITR) ligand, or ectodysplasin A2 (EDA-A2). In some embodiments, the ... , NT-4, GITR ligand, or EDA-A2, includes the TNF-like ... (GITR) ligand, or ectodysplasin A2 (EDA-A2). 6. The CAR polypeptide of ... -4, GITR ligand, TL1 A, or EDA-A2. 4. The CAR polypeptide of ... activating receptors CD3 zeta, CD3 eta, or CD3 theta are described ... -4, GITR ligand, TL1 A, or EDA-A2)) can be used to ... (GITR) ligand, or ectodysplasin A2 (EDA-A2). 6. The CAR polypeptide of ...
Dispositivo para el empaquetado y almacenaje de envases usados para su reciclaje
Патент от
18 апреля 2016 года

Заявител(и)ь: SANCHEZ CARRO Sofia

Изобретател(и)ь: SANCHEZ CARRO Sofia

Номер заявки:

Дата заявки: 18.04.2016

Классификация: A44B0018000000, A44B0099000000

Дата международной регистрации:

Международные идентификаторы:

Вес (релевантность к запросу): 1722.7782


... sería una especie de lengüeta de caucho u otro polímero ... donde puede apreciarse la lengüeta (1) unida al envase, tal y como ... envases. Fig 2. Muestra la lengüeta (1) separada menos por su parte ... uso. Fig 3. Muestra la lengüeta (1) levantada y el comienzo de plegado ... con varios pliegues, y la lengüeta (1) suelta para su uso. 2 Fig ... envase totalmente plegado y la lengüeta (1) estirándose para abrazar el ... ón de la lengüeta (1). Fig 6. Muestra la lengüeta (1) estirada todo lo ... doblado. Fig 7. Muestra la lengüeta (1) andada al envase de forma ... posible situación de la lengüeta (1). Fig 12. Muestra paso a paso ... ser una especie de lengüeta seccionada en la parte central ... que no sea una lengüeta sino un aro, tira, etc ...
Transportanordning
Патент от
25 сентября 2016 года

Заявител(и)ь: JONNY ERIKSSON

Изобретател(и)ь: JONNY ERIKSSON

Номер заявки:

Дата заявки: 25.09.2016

Классификация: B60R9-0423, B60R9-055, B60R0009042000, B60R0009055000

Дата международной регистрации:

Международные идентификаторы:

Вес (релевантность к запросу): 1722.7782


Transportanordning. (SV) Stegbox innefattande ett hölje (1) med en ovansida och ... är begränsat utdragbar ur höljet (1).Ett handtag (11) är monterat på gavelns utsida ... U-formade profilerna frigivits från ett anslag eller spärr som ... . Handtaget kan tjäna som ett skonsamt anslag eller stöd mot ... ) Transportanordning Реферат (SV) Stegbox innefattande ett hölje (1) med en ovansida och ... är begränsat utdragbar ur höljet (1).Ett handtag (11) är monterat på gavelns utsida ... U-formade profilerna frigivits från ett anslag eller spärr som ... . Handtaget kan tjäna som ett skonsamt anslag eller stöd mot ... ) Transportanordning Реферат (SV) Stegbox innefattande ett hölje (1) med en ovansida och ... är begränsat utdragbar ur höljet (1).Ett handtag (11) är monterat på gavelns utsida ... U-formade profilerna frigivits från ett anslag eller spärr som ... . Handtaget kan tjäna som ett skonsamt anslag eller stöd mot ...
SELF-ASSEMBLING VEGF NANOPARTICLES
Патент от
14 мая 2020 года

Заявител(и)ь: NORTHWESTERN UNIVERSITY

Изобретател(и)ь: OPAL, Puneet;STUPP, Samuel I.

Номер заявки:

Дата заявки:

Классификация: A61K38-00, B82Y5-00, C07K14-52, A61K0038160000

Дата международной регистрации: 08.11.2019

Международные идентификаторы: WO/2020/097460, PCT/US2019/060466

Вес (релевантность к запросу): 1722.7782


... acidic peptide segment comprising EEE, EED, EDE, DEE, EDD, DED, DDE, or DDD ... acidic peptide segment comprising EEE, EED, EDE, DEE, EDD, DED, DDE, or DDD ... acidic peptide segment comprising EEE, EED, EDE, DEE, EDD, DED, DDE, or DDD ... acidic peptide segment comprising EEE, EED, EDE, DEE, EDD, DED, DDE, or DDD ...
High Average Power High Efficiency Broadband All-Optical Fiber Wavelength Converter
Патент от
26 октября 2006 года

Заявител(и)ь: OPAL LABORATORIES;KEOPSYS, INC.

Изобретател(и)ь: Marhic Michael E.;Williams Glen M.;Goldberg Lew;Delavaux Jean-Marc P.

Номер заявки:

Дата заявки: 26.10.2006

Классификация: G02B0006000000

Дата международной регистрации:

Международные идентификаторы:

Вес (релевантность к запросу): 1720.9521


... , the roots of Eq.(1) are {eta 1, eta 2, eta 3, eta 4}. Here x=0 is a root of h(x)=0, which ... can be shown to be eta 2. As ... positive roots, hence between 0 and eta 3. The equation h(x)/x=0 is a third-order ... , and therefore its three roots {eta 1, eta 3, eta 4} can be written explicitly in ... , which is also eta 3; so we must have eta 3=P 10/2. Substituting into ...
A Novel Complex Comprising A Cell Penetrating Peptide, A Cargo And A TLR Peptide Agonist For Treatment Of Colorectal Cancer
Патент от
17 мая 2018 года

Заявител(и)ь: Amal Therapeutics SA

Изобретател(и)ь: Madiha DEROUAZI;Elodie BELNOUE

Номер заявки:

Дата заявки: 17.05.2018

Классификация: A61K2039-6031, A61K38-10, A61K39-0011, A61K47-6811, A61P1-00, A61P35-00, C07K2319-10, C07K2319-40, C12N2710-16233, A61K0047680000, A61K0039000000, A61K0038100000, A61P0035000000, A61P0001000000

Дата международной регистрации:

Международные идентификаторы:

Вес (релевантность к запросу): 1720.9521


... ; URL: http://cvc.dfci.harvard.edu/tadb/). Examples of cancer/tumor ... ; URL: http://cvc.dfci.harvard.edu/tadb/). EpCAM Ep-Cam is ... ; URL: http://cvc.dfci.harvard.edu/tadb/). Mucin-1 (MUC-1 ... ; URL: http://cvc.dfci.harvard.edu/tadb/). A “sequence variant” is as ... isoforms is the extra domain A (EDA), which interacts with TLR4. Further ... TLR peptide agonists comprise a fibronectin EDA domain or a fragment or variant ... thereof. Such suitable fibronectin EDA domains or a fragments or variants ... -US-00025] (TLR4 peptide agonist EDA) SEQ ID NO: 45 NIDRPKGLAFTDVDVDSIKIAWESPQGQVSRYRVTYSSPED ... Mad5 and MPLA (equimolar to EDA). Mice were bled 7 days after ... Mad5 and MPLA (equimolar to EDA). Mice were bled 7 days after ... Mad5 and MPLA (equimolar to EDA). Mice were bled 7 days after ...
A NOVEL COMPLEX COMPRISING A CELL PENETRATING PEPTIDE, A CARGO AND A TLR PEPTIDE AGONIST FOR TREATMENT OF COLORECTAL CANCER
Патент от
22 сентября 2016 года

Заявител(и)ь: AMAL THERAPEUTICS SA

Изобретател(и)ь:

Номер заявки:

Дата заявки: 22.09.2016

Классификация: A61K39-0011, A61K39-385, A61K2039-6031, C07K14-70514, C07K14-70517, C07K2319-10, C07K2319-40, A61K38-10, A61K38-17, A61K38-177, A61P1-00, A61P35-00, C12N2710-16233, Y02A50-30, A61K47-42, A61K47-6425, A61K47-6811, A61K47-6865, A61K2039-5154, C07K2319-02, C07K2319-03, C07K2319-33, A61K38-1764, A61K47-64, A61K47-6803, A61K0039385000, A61K0047660000, A61K0038160000, A61P0035000000, A61P0037040000

Дата международной регистрации:

Международные идентификаторы:

Вес (релевантность к запросу): 1720.9521


... ; URL: http://cvc.dfki.harvard.edu/tadb/). Examples of cancer/tumor ... ; URL: http://cvc.dfki.harvard.edu/tadb/). EpCAM Ep-Cam is ... ; URL: http://cvc.dfki.harvard.edu/tadb/). Mucin-1 (MUC-1 ... ; URL: http://cvc.dfki.harvard.edu/tadb/). 5 A sequence variant" is as ... isoforms is the extra domain A (EDA), which interacts with TLR4. Further ... TLR peptide agonists comprise a fibronectin EDA domain or a fragment or variant ... thereof. Such suitable fibronectin EDA domains or a fragments or variants ... NO: 45 (TLR4 peptide agonist EDA) In addition, high-mobility group ... Made and MPLA (equimolar to EDA). Mice were bled 7 days after ... Made and MPLA (equimolar to EDA). Mice were bled 7 days after ... Made and MPLA (equimolar to EDA). Mice were bled 7 days after ...
CORE 22 HUMAN TRAINING AND WEIGHT LOSS SYSTEM
Патент от
13 июля 2017 года

Заявител(и)ь: Sky Leeland Canine;Richard Schmitt

Изобретател(и)ь: Sky Leeland Canine;Richard Schmitt

Номер заявки:

Дата заявки: 13.07.2017

Классификация: G09B19-0092, G09B19-00, G09B0019000000

Дата международной регистрации:

Международные идентификаторы:

Вес (релевантность к запросу): 1718.8


... ) if the user 1 did not eat within three hours of going ... ) if the user 1 did not eat within three hours of going ... ) if the user 1 did not eat within three hours of going ... method; did the user 1 only eat foods 6 approved in the materials ... the method; did the user 1 eat enough of the vegetables listed ... the method; did the user 1 eat no more than a prescribed limit ... the method; did the user 1 eat the prescribed amount of protein ... ; did the user 1 eat less than the maximum prescribed ... ) if the user did not eat within three hours of going ... ) if the user did not eat within three hours of going ...
SUPPLY FOR TELEVISION DISPLAY TUBES
Патент от
26 июня 1974 года

Заявител(и)ь: MULLARD LTD EHT

Изобретател(и)ь:

Номер заявки:

Дата заявки: 26.06.1974

Классификация: H02M7-062, H02M7-103, H04N3-18, H04N3-185, H02M0007060000, H02M0007100000, H04N0003180000, H04N0003185000

Дата международной регистрации:

Международные идентификаторы:

Вес (релевантность к запросу): 1718.8


... TELEVISION DISPLAY TUBES. (EN) 1357971 EHT supplies for cathode-ray tubes ... 1170198 Heading H2F In an EHT supply for TV apparatus comprising ... the EHT winding 3 of a line output transformer ... the earthy end of the EHT winding 3. The resistance may be ... between the terminals of the EHT winding 3 in order to reduce ... the internal resistance of the EHT source and so provide clipping ... to the junction of the EHT winding 3 of the line output ... the picture display tube, the EHT lead, that is to say ... to the junction of the EHT winding 3 of the line output ... the picture display tube, the EHT lead, that is to say ...
USE OF EPOXYEICOSATRIENOIC ACIDS IN THE TREATMENT OF CEREBROVASCULAR CONDITIONS
Патент от
06 декабря 2001 года

Заявител(и)ь: THE BRIGHAM AND WOMEN'S HOSPITAL, INC.;THE GENERAL HOSPITAL CORPORATION

Изобретател(и)ь: LIAO, James, K.;MOSKOWITZ, Michael, A.

Номер заявки:

Дата заявки:

Классификация: A61K31-01, A61K31-015, A61K31-20, A61K31-335, A61K31-336, A61K31-35, A61K31-352, A61K31-357, A61P9-10, A61K0031010000, A61K0031015000, A61K0031200000, A61K0031335000, A61K0031336000, A61K0031350000, A61K0031352000, A61K0031357000

Дата международной регистрации: 30.05.2001

Международные идентификаторы: WO/2001/091745, PCT/US2001/017452

Вес (релевантность к запросу): 1718.8


... graph showing the effects of EET and vehicle infusion in animals ... a graph showing the effects of EET and vehicle infusion to the ... a graph showing the effects of EET and vehicle infusion to the ... . A number of EETs and/or EET derivatives are readily available from ... methods known in the art (e.g., EET-sulfonimides can be synthesized as ... agent of the invention (e.g., an EET, and/or a cytochrome P-450 ... , it is desired to increase EET and/or a cytochrome P-450 ... compounds of the invention (e.g., an EET and a cytochrome P-450 epoxygenase ... inducer, or an EET and an agent known to ... , 1997, 1:515-526). 11,12 EET (Sigma Chemical Co., St Louis ...
КОМПОЗИЦИИ И СПОСОБЫ ДЛЯ ЛЕЧЕНИЯ АНЕМИИ
Патент от
29 июня 2018 года

Заявител(и)ь: ЭКЕБИА ТЕРАПЬЮТИКС, ИНК.

Изобретател(и)ь: Смит Александр;Чандоркар Гурудатт Аджай;Этте Эне Икпонг;Марони Брэдли Джон;Хартманн Шарлотт Сьюзанн;Фарзанех-Фар Рамин;Инриг Джула Керн

Номер заявки:

Дата заявки: 29.06.2018

Классификация: A61K9-2059, A61K9-2866, A61K31-16, A61K31-4418, A61P7-06, C07D213-81, A61K9-2009, A61K9-2013, A61K9-2054, A61K0031160000

Дата международной регистрации:

Международные идентификаторы:

Вес (релевантность к запросу): 1718.8


... , во время визитов в процессе исследования и EOT, и это нужно сделать до взятия ... 1 или дарбэпоэтин альфа) и вплоть до EOT визита, должны быть зарегистрированы. [00385 ... крови также берут во время EOT визита. Тесты функции печени включают ... крови также берут во время EOT визита. Оценки включают следующие индексы ... на Неделе 12, Неделе 28 и EOT. Образцы крови для ЕРО анализа ... 12 и 52 (или во время EOT визита, если субъект постоянно прерывает ... протяжении всего исследования. [00425] При EOT визите осуществляют следующие действия/процедуры ... следует осуществлять только во время EOT визита для субъектов, участвующих в дополнительном ... по телефону через 4 недели после EOT визита. Осуществляют следующие действия/процедуры ... или при визите окончания лечения (EOT), если субъект постоянно прерывает прием ...
NEUARTIGER KOMPLEX MIT EINEM ZELLPENETRIERENDEN PEPTID, EINEM CARGO- UND EINEM TLR-PEPTID-AGONISTEN ZUR BEHANDLUNG VON KOLOREKTALKARZINOM
Патент от
12 августа 2020 года

Заявител(и)ь: AMAL THERAPEUTICS SA

Изобретател(и)ь: DEROUAZI MADIHA;BELNOUE ELODIE

Номер заявки:

Дата заявки: 12.08.2020

Классификация: A61K39-0011, A61K39-385, A61K2039-6031, C07K14-70514, C07K14-70517, C07K2319-10, C07K2319-40, A61K38-10, A61K38-17, A61K38-177, A61P1-00, A61P35-00, C12N2710-16233, Y02A50-30, A61K47-42, A61K47-6425, A61K47-6811, A61K47-6865, A61K2039-5154, C07K2319-02, C07K2319-03, C07K2319-33, A61K38-1764, A61K47-64, A61K47-6803, A61K0039000000

Дата международной регистрации:

Международные идентификаторы:

Вес (релевантность к запросу): 1718.8


... ; URL: http://cvc.dfci.harvard.edu/tadb/). Examples of cancer/tumor ... ; URL: http://cvc.dfci.harvard.edu/tadb/). EpCAM [0114] Ep-Cam ... ; URL: http://cvc.dfci.harvard.edu/tadb/). Mucin-1 (MUC-1 ... ; URL: http://cvc.dfci.harvard.edu/tadb/). [0158] A "sequence variant" is ... isoforms is the extra domain A (EDA), which interacts with TLR4. [0187 ... TLR peptide agonists comprise a fibronectin EDA domain or a fragment or variant ... thereof. Such suitable fibronectin EDA domains or a fragments or variants ... Mad5 and MPLA (equimolar to EDA). Mice were bled 7 days after ... Mad5 and MPLA (equimolar to EDA). Mice were bled 7 days after ... Mad5 and MPLA (equimolar to EDA). Mice were bled 7 days after ...
NEUARTIGER KOMPLEX MIT EINEM ZELLPENETRIERENDEN PEPTID, EINEM CARGO- UND EINEM TLR-PEPTID-AGONISTEN ZUR BEHANDLUNG VON KOLOREKTALKREBS
Патент от
24 января 2018 года

Заявител(и)ь: AMAL THERAPEUTICS SA

Изобретател(и)ь: DEROUAZI MADIHA;BELNOUE ELODIE

Номер заявки:

Дата заявки: 24.01.2018

Классификация: A61K39-0011, A61K39-385, A61K2039-6031, C07K14-70514, C07K14-70517, C07K2319-10, C07K2319-40, A61K38-10, A61K38-17, A61K38-177, A61P1-00, A61P35-00, C12N2710-16233, Y02A50-30, A61K47-42, A61K47-6425, A61K47-6811, A61K47-6865, A61K2039-5154, C07K2319-02, C07K2319-03, C07K2319-33, A61K38-1764, A61K47-64, A61K47-6803, A61K0039000000

Дата международной регистрации:

Международные идентификаторы:

Вес (релевантность к запросу): 1718.8


... ; URL: http://cvc.dfci.harvard.edu/tadb/). Examples of cancer/tumor ... ; URL: http://cvc.dfci.harvard.edu/tadb/). EpCAM [0118] Ep-Cam ... ; URL: http://cvc.dfci.harvard.edu/tadb/). Mucin-1 (MUC-1 ... ; URL: http://cvc.dfci.harvard.edu/tadb/). [0163] A "sequence variant" is ... isoforms is the extra domain A (EDA), which interacts with TLR4. [0202 ... TLR peptide agonists comprise a fibronectin EDA domain or a fragment or variant ... thereof. Such suitable fibronectin EDA domains or a fragments or variants ... Mad5 and MPLA (equimolar to EDA). Mice were bled 7 days after ... Mad5 and MPLA (equimolar to EDA). Mice were bled 7 days after ... Mad5 and MPLA (equimolar to EDA). Mice were bled 7 days after ...
ПРИМЕНЕНИЕ ДИАЗЕПИНОВ ДЛЯ ПРИГОТОВЛЕНИЯ ЛЕКАРСТВЕННЫХ СРЕДСТВ, ПРЕДНАЗНАЧЕННЫХ ДЛЯ ЛЕЧЕНИЯ ПАТОЛОГИЧЕСКИХ СОСТОЯНИЙ ИЛИ ЗАБОЛЕВАНИЙ, СВЯЗАННЫХ С ДЕЙСТВИЕМ ОДНОГО ИЗ РЕЦЕПТОРОВ СОМАТОСТАТИНА
Патент от
27 мая 2004 года

Заявител(и)ь:

Изобретател(и)ь: BIGG Denni (FR);БИГГ Денни (FR);LIBERATOR Ann-Mari (FR);ЛИБЕРАТОР Анн-Мари (FR);POMM'E Zhak (FR);ПОММЬЕ Жак (FR);TEJLOR Dzhon (US);ТЕЙЛОР Джон (US)

Номер заявки: 2001101481/15

Дата заявки: 27.05.2004

Классификация: C07D495-22 , 7A 61K 31/5517 A, 7C 07D 495/22 B, 7A 61P 5/00 B, 7 A 61 K 31/5517, C 07 D 495/22, A 61 P 5/00

Дата международной регистрации:

Международные идентификаторы:

Вес (релевантность к запросу): 1716.2258


... ; S; 2-Cl; H; H; Me; - 2-NO 2-4-EtO-Ph; NH; S; 2-Cl; H; H; Me ... -Ph; NH; S; 2-Cl; H; H; Me; - 2-EtO-Ph; NH; S; 2-Cl; H; H; Me ... ; S; 2-Cl; H; H; Me; - 2-NO 2-4-EtO-Ph; NH; S; 2-Cl; H; H; Me ... ; S; 2-Cl; H; H; Me; - 2-NO 2-4-EtO-Ph; NH; S; 2-Cl; H; H; Me ... -Ph; NH; S; 2-Cl; H; H; Me; - 2-EtO-Ph; NH; S; 2-Cl; H; H; Me ... ; S; 2-Cl; H; H; Me; - 2-NO 2-4-EtO-Ph; NH; S; 2-Cl; H; H; Me ... ; S; 2-Cl; H; H; Me; - 2-NO2-4-EtO-Ph; NH; S; 2-Cl; H; H; Me ... -Ph; NH; S; 2-Cl; H; H; Me; - 2-EtO-Ph; NH; S; 2-Cl; H; H; Me ... ; S; 2-Cl; H; H; Me; - 2-NO2-4-EtO-Ph; NH; S; 2-Cl; H: H; Me ...
СПОСОБ ПОЛУЧЕНИЯ ПРОДУКТА ИЗ ДРОБЛЕНОГО ЦЕЛЬНОЗЕРНОВОГО РИСА
Патент от
20 ноября 2015 года

Заявител(и)ь: ИНТЕРКОНТИНЕНТАЛ ГРЕЙТ БРЕНДС ЛЛК (US)

Изобретател(и)ь: КАРВОВСКИ Ян (US);ВЕМУЛАПАЛЛИ Вани (US);БАУМАНН Барбара Е. (US)

Номер заявки: 2014114168/13

Дата заявки: 20.11.2015

Классификация: A23L7-10, A23L7-117, A23L7-122, A23L7-139, A23L7-197, A23L7-1975, A23L0001164000

Дата международной регистрации:

Международные идентификаторы:

Вес (релевантность к запросу): 1713.0923


... other shapes of ready-to-eat type; Semi-finished or partly ... other shapes of ready-to-eat type; Semi-finished or partly ... , multilayered or hollow ready-to-eat cereals$(function(){PrimeFaces.cw("Tooltip ... other shapes of ready-to-eat type; Semi-finished or partly ... other shapes of ready-to-eat type; Semi-finished or partly ... other shapes of ready-to-eat type; Semi-finished or partly ... , multilayered or hollow ready-to-eat cereals$(function(){PrimeFaces.cw("Tooltip ... other shapes of ready-to-eat type; Semi-finished or partly ...
НОВЫЕ АНТИТЕЛА, КОТОРЫЕ СПЕЦИФИЧЕСКИ СВЯЗЫВАЮТСЯ С ЭПИТОПАМИ ВИРУСА ЗИКА, И ИХ ПРИМЕНЕНИЯ
Патент от
31 июля 2019 года

Заявител(и)ь: ХУМАБС БИОМЕД СА

Изобретател(и)ь: Корти Давиде

Номер заявки:

Дата заявки: 31.07.2019

Классификация: A61K2039-505, C07K16-1081, C07K2317-21, C07K2317-33, C07K2317-76, Y02A50-30, A61P31-12, A61P31-14, A61P31-20, C07K2317-524, A61K9-0019, G01N33-56983, C07K0016100000

Дата международной регистрации:

Международные идентификаторы:

Вес (релевантность к запросу): 1713.0923


... три различных домена: домен I Е белка (EDI), домен II Е белка (EDII), и домен ... I/II белка оболочки вируса Зика (EDI/II). Более предпочтительно, антитело или ... один или несколько аминокислотных остатков EDI-EDIII шарнирной области. EDIII латеральный ... гребень и EDI-EDIII шарнирная область известны квалифицированному ... состояния слияния вируса и (II) связывание с EDI-EDIII шарниром и EDIII может препятствовать ... , образуя димер (“оболочечный димерный эпитоп”; EDE) или он может быть образован ... один или несколько аминокислотных остатков EDI-EDIII шарнирной области. 15. Антитело ... и один или несколько аминокислотных остатков EDI-EDIII шарнирной области. 16. Антитело ...
Device for recording start sequences of car, has command and control unit including input connected to common point between control coil of relay and bypass switch, and another input connected to motor rotation detection sensor
Патент от
22 ноября 2013 года

Заявител(и)ь: AIH SOFT

Изобретател(и)ь: GASO PHILIPPE

Номер заявки:

Дата заявки: 22.11.2013

Классификация: B60K28-063, B60K28-066, B60W2540-24, B60Y2302-03, F02N11-0818, F02N11-0822, F02N11-101, F02N2200-022, F02N2200-041, F02N2200-08, F02N2200-0801, F02N2200-10, F02N2200-106, F02N2200-123, F02N2300-306, Y02T10-40, B60R0025040000, B60W0010060000

Дата международной регистрации:

Международные идентификаторы:

Вес (релевантность к запросу): 1709.1942


... un éthylotest anti-démarrage (EAD). L’invention trouve notamment son application ... équipés d’éthylotests anti-démarrage (EAD). Ces dispositifs permettent d’imposer un ... test est négatif, le dispositif EAD autorise le démarrage du véhicule ... le cas contraire, le dispositif EAD bloque la consigne de démarrage ... de démarrage incorporant un dispositif EAD sont équipés d’un interrupteur de ... des conditions anormales. Les dispositifs EAD présentent un autre désavantage ... n’existe pas de boîtier EAD unique, plusieurs fabricants proposant des ...
SYSTEM FOR PLANNING MEALS
Патент от
19 марта 2015 года

Заявител(и)ь: Mary Egan

Изобретател(и)ь: Mary Egan

Номер заявки:

Дата заявки: 19.03.2015

Классификация: G09B19-0092, G09B5-02, G09B0019000000, G09B0005020000

Дата международной регистрации:

Международные идентификаторы:

Вес (релевантность к запросу): 1709.1942


... the family is going to eat over a given period (e.g., the following ... diabetic, concerned about heart health, eat a kosher diet, are athletes in ... specify that he wishes to eat kosher for a particular week. As ... family members on what to eat earlier in the day (e.g., so ... as to not eat the same thing for lunch ... to go to a party, eat at a restaurant, eat dinner at a grandparent's house ...
СПОСОБ СИГНАЛИЗАЦИОННОГО ПРИКРЫТИЯ ПЕРЕКРЕСТКА ДОРОГ
Патент от
10 января 2017 года

Заявител(и)ь:

Изобретател(и)ь: Удот Сергей Александрович (RU);Рябец Александр Яковлевич (RU);Осокин Дмитрий Леонидович (RU);Михайлов Роман Александрович (RU);Udot Sergej Aleksandrovich (RU);Ryabets Aleksandr Yakovlevich (RU);Osokin Dmitrij Leonidovich (RU);Mikhajlov Roman Aleksandrovich (RU)

Номер заявки: 2015138371

Дата заявки: 10.01.2017

Классификация: G08B0025100000

Дата международной регистрации:

Международные идентификаторы:

Вес (релевантность к запросу): 1709.1942


... ) with an extended detection area (EDA) built on radio beam or ... to the points of the EDA crossing the road relate as ... mutually reverse directions, respectively, the EDA of the first DM passes ... an intruder getting in its EDA and automatic switching over to ... when the intruder leaves the EDA; further determining the intruder movement ... terrain and distances between the EDA at these directions of movement ... and the distance between the EDA by the roads. EFFECT: thus ...
ВИРУС ГРИППА, СПОСОБНЫЙ ИНФИЦИРОВАТЬ СОБАЧЬИХ, И ЕГО ПРИМЕНЕНИЕ
Патент от
20 июня 2014 года

Заявител(и)ь:

Изобретател(и)ь: КРОУФОРД Пэтти К (US);ГИББЗ Пол Дж (US);ДУБОВИ Эдвард Дж (US);ДОНИС Рубен О (US);КАЦ Жаклин (US);КЛИМОВ Александр И (US);ЛАКШМАНАН Наллаканну П (US);ЛАМ Мелисса Энн (US);ГОВАРТС Даниэль Гислена Эмиль (NL);МЕЛЛЕНКЕМП Марк Уилльям (US);КОКС Нэнси Дж (US);КАСЛМАН Уилльям Л (US);KROUFORD Pehtti K (US);GIBBZ Pol Dzh (US);DUBOVI Ehdvard Dzh (US);DONIS Ruben O (US);KATs Zhaklin (US);KLIMOV Aleksandr I (US);LAKShMANAN Nallakannu P (US);LAM Melissa Ehnn (US);GOVARTS Daniehl' Gislena Ehmil' (NL);MELLENKEMP Mark Uill'jam (US);KOKS Nehnsi Dzh (US);KASLMAN Uill'jam L (US)

Номер заявки: 2008119461/10

Дата заявки: 20.06.2014

Классификация: A61K39-145 , A61K39-00 , A61K39-12 , A61K2039-5252, A61K2039-5254, A61K2039-54, A61K2039-543, A61K2039-552, A61K2039-55555, A61K2039-70, C07K14-005 , C12N7-00 , C12N2760-16121, C12N2760-16122, C12N2760-16134, C12N2760-16143, G01N33-56983 , G01N2333-11, G01N2500-10, G01N2800-12, A61K0039145000, C12N0007000000, C07K0014110000

Дата международной регистрации:

Международные идентификаторы:

Вес (релевантность к запросу): 1709.1942


... : инактивированный A/Pa/63 at 10 6,0 EID 50, инактивированный A/KY/93 при ... 10 6,7 EID 50, 0,25% по объему карбопол ... по меньшей мере приблизительно 10 3 EID 50/животное (Canidae) и более типично ... приблизительно 10 3 - приблизительно 10 9 EID 50/животное (Canidae). В некоторых вариантах ... меньшей мере на приблизительно 10 0,5 EID 50/животное (Canidae) больше, чем ... /3/2003 (H3N2) при 10 6,67 EID 50/мл (HA=64) и A/canine ... /2003(H3N8) при 10 7,17 EID 50/мл (HA=16), использовали ...
ВИРУС ГРИППА, СПОСОБНЫЙ ИНФИЦИРОВАТЬ СОБАЧЬИХ, И ЕГО ПРИМЕНЕНИЕ
Патент от
22 января 2020 года

Заявител(и)ь:

Изобретател(и)ь: КРОУФОРД Пэтти К. (US);ГИББЗ Пол Дж. (US);ДУБОВИ Эдвард Дж. (US);ДОНИС Рубен О. (US);КАЦ Жаклин (US);КЛИМОВ Александр И. (US);ЛАКШМАНАН Наллаканну П. (US);ЛАМ Мелисса Энн (US);ГОВАРТС Даниэль Гислена Эмиль (NL);МЕЛЛЕНКЕМП Марк Уилльям (US);КОКС Нэнси Дж. (US);КАСЛМАН Уилльям Л. (US);KROUFORD Petti K. (US);GIBBZ Pol Dzh. (US);DUBOVI Edvard Dzh. (US);DONIS Ruben O. (US);KATS Zhaklin (US);KLIMOV Aleksandr I. (US);LAKSHMANAN Nallakannu P. (US);LAM Melissa Enn (US);GOVARTS Daniel Gislena Emil (NL);MELLENKEMP Mark Uillyam (US);KOKS Nensi Dzh. (US);KASLMAN Uillyam L. (US)

Номер заявки: 2014101481

Дата заявки: 22.01.2020

Классификация: A61K39-00, A61K39-12, A61K39-145, A61K2039-5252, A61K2039-5254, A61K2039-54, A61K2039-543, A61K2039-552, A61K2039-55555, A61K2039-70, A61P11-00, A61P31-12, A61P31-16, A61P37-04, A61P43-00, C07K14-005, C12N7-00, C12N2760-16121, C12N2760-16122, C12N2760-16134, C12N2760-16143, G01N33-56983, G01N2333-11, G01N2500-10, G01N2800-12, C07K14-11, A61K0039145000, C07K0014110000, C12N0007000000, C12N0015440000

Дата международной регистрации:

Международные идентификаторы:

Вес (релевантность к запросу): 1709.1942


... : инактивированный A/Pa/63 at 10 6,0 EID 50, инактивированный A/KY/93 при ... 10 6,7 EID 50, 0,25% по объему карбопол ... по меньшей мере приблизительно 10 3 EID 50/животное (Canidae) и более типично ... приблизительно 10 3 - приблизительно 10 9 EID 50/животное (Canidae). В некоторых вариантах ... меньшей мере на приблизительно 10 0,5 EID 50/животное (Canidae) больше, чем ... /3/2003 (H3N2) при 10 6,67 EID 50/мл (HA=64) и A/canine ... /2003(H3N8) при 10 7,17 EID 50/мл (HA=16), использовали ...
АНТАГОНИСТЫ TOLL-ПОДОБНОГО РЕЦЕПТОРА 3, СПОСОБЫ ИХ ПОЛУЧЕНИЯ И ПРИМЕНЕНИЕ
Патент от
30 декабря 2009 года

Заявител(и)ь: СЕНТОКОР, ИНК.

Изобретател(и)ь: Картон Джилл;Каннингхэм Марк;Дас Анук;Даффи Карен;Найт Дэвид М.;Лэмб Роберта;Мбоу Моухамадоу Л.;Рагхунатхан Гопалан;Сан Матео Лани;Сариски Роберт Т.;Стоуэлл Николь;Свит Рэймонд;Чжао Шаньжун;Чэнь Шичжун;Джайлс-Комар Джилл;Пича Кристен;Стоянович-Сусулич Ведрана;Голетц Тереза Дж.

Номер заявки:

Дата заявки: 30.12.2009

Классификация: A61K2039-505, A61P1-00, A61P1-02, A61P1-04, A61P1-16, A61P1-18, A61P3-04, A61P3-06, A61P3-10, A61P5-00, A61P9-10, A61P9-14, A61P11-00, A61P11-06, A61P13-12, A61P17-00, A61P17-02, A61P17-06, A61P19-00, A61P19-02, A61P19-10, A61P21-02, A61P21-04, A61P25-00, A61P25-14, A61P25-16, A61P25-18, A61P25-28, A61P27-02, A61P29-00, A61P31-00, A61P31-04, A61P31-10, A61P31-12, A61P31-16, A61P31-18, A61P31-20, A61P33-00, A61P35-00, A61P37-00, A61P37-02, A61P37-04, A61P37-06, A61P37-08, A61P43-00, C07K16-2896, C07K2317-24, C07K2317-56, C07K2317-565, C07K2317-567, C07K2317-76, C07K2317-92, A61K0039395000

Дата международной регистрации:

Международные идентификаторы:

Вес (релевантность к запросу): 1704.2134


... /onlinecomp . html ; www.public . iastate . edu/-pedro/research_tools . html ; www ... /~mrc7/mikeimages . html ; mcb . harvard . edu/BioLinks/Immunology. html ; www. immunologylink ... . com; pathbox. wustl . edu/-hcenter/inde . html ; www ... .cancerresearchuk.org; www.biotech.ufl.edu; www.isac-net.org; baserv ... -hd . de/immuno . bme . nwu . edu; www . mrc-cpe . cam .ac ... /stat_aim.html ; www . biosci . missouri . edu/smithgp/inde . html ; www. j erini ...
КАТАЛИЗАТОРЫ, СОДЕРЖАЩИЕ СЕРЕБРО, ПОЛУЧЕНИЕ ТАКИХ КАТАЛИЗАТОРОВ И ИХ ПРИМЕНЕНИЕ
Патент от
10 января 2009 года

Заявител(и)ь:

Изобретател(и)ь: МАТУШ Марек (US);РИЧАРД Майкл Алан (US);ЛОКМЕЙЕР Джон Роберт (US);БОС Алауисиус Николас Рене (NL);РЕКЕРС Доминикус Мария (NL);РЕЙНАЛДА Доналд (NL);ЙЕТС Рэндалл Клейтон (US);MATUSh Marek (US);RIChARD Majkl Alan (US);LOKMEJER Dzhon Robert (US);BOS Alauisius Nikolas Rene (NL);REKERS Dominikus Marija (NL);REJNALDA Donald (NL);JETS Rehndall Klejton (US)

Номер заявки: 2005138025/04

Дата заявки: 10.01.2009

Классификация: B01J23-58 , B01J23-50 , B01J23-63 , B01J23-683 , B01J23-688 , B01J35-02 , B01J35-026 , B01J35-1009 , B01J35-1014 , B01J37-0203 , B01J37-0213 , C07D301-10 , Y02P20-52 , B01J0035020000, B01J0023656000, B01J0037020000, B01J0023580000, B01J0023500000, C07D0301100000, B01J0023630000, B01J0023680000, C07D0301000000, B01J0035100000

Дата международной регистрации:

Международные идентификаторы:

Вес (релевантность к запросу): 1704.2134


... добавляли к раствору 732 г 92% этилендиамина (EDA). В это время температуру поддерживали ниже ... с раствором 0,1235 г NH 4ReO 4 в 2 г смеси EDA/H 2O 1:1, раствором 0,0574 г метавольфрамата аммония ... с раствором 0,1051 г NH 4ReO 4 в 2 г смеси EDA/H 2O 1:1, раствором 0,0488 г метавольфрамата аммония ... с раствором 0,1378 г NH 4ReO 4 в 2 г смеси EDA/H 2O 1:1, раствором 0,064 г метавольфрамата аммония ... с раствором 0,2915 г NH 4ReO 4 в 2 г смеси EDA/H 2O 1:1, раствором 0,0678 г метавольфрамата аммония ... с раствором 0,2906 г NH 4ReO 4 в 1 г смеси EDA/H 2O 1:1 и раствором 0,3735 г LiNO 3 в 1 г воды ...
EXHAUST GAS EXHAUST SYSTEM WITHOUT A DIESEL OXIDATION CATALYST (DOC) HAVING AN AMMONIA SLIP CATALYST (ASC) ACTING AS DOC IN A SYSTEM WITH A SELECTIVE CATALYTIC REDUCTION (SCR) CATALYST BEFORE ASC
Патент от
18 июля 2019 года

Заявител(и)ь:

Изобретател(и)ь: ЛАРССОН, Микаэль (SE);LARSSON, Mikael (SE)

Номер заявки: 2018101714

Дата заявки: 18.07.2019

Классификация: B01D53-9418, B01D53-9436, B01D53-944, B01D53-9472, B01D2255-1021, B01D2255-1023, B01D2255-20738, B01D2255-20761, B01D2255-50, B01D2255-9032, B01J29-743, B01J29-763, B01J29-783, B01J35-0006, B01J35-04, B01J37-0244, B01J37-0246, B01J2229-18, B01J2229-186, B01J2229-36, F01N3-106, F01N3-2066, F01N3-2828, F01N13-0093, F01N13-0097, F01N2330-06, F01N2370-04, F01N2510-0684, F01N2570-14, F01N2570-18, Y02A50-20, Y02T10-12, B01D53-94, B01J23-42, B01J23-44, B01J23-70, B01J23-72, B01J23-745, B01J29-76, B01D2255-20723, B01D2255-9022, B01D2255-9037, B01D2255-915, B01J21-04, B01J23-6482, F01N0003200000, F01N0003280000, F01N0003100000

Дата международной регистрации:

Международные идентификаторы:

Вес (релевантность к запросу): 1704.2134


... , CDO, CHA, DDR, DFT, EAB, EDI, EPI, ERI, GIS, GOO, IHW ... , CDO, CHA, DDR, DFT, EAB, EDI, EPI, ERI, GIS, GOO, IHW ... , CDO, CHA, DDR, DFT, EAB, EDI, EPI, ERI, GIS, GOO, IHW ... , CDO, CHA, DDR, DFT, EAB, EDI, EPI, ERI, GIS, GOO, IHW ... , CDO, CHA, DDR, DFT, EAB, EDI, EPI, ERI, GIS, GOO, IHW ... , CDO, CHA, DDR, DFT, EAB, EDI, EPI, ERI, GIS, GOO, IHW ...
COMBINATION OF AN IMMUNE CHECKPOINT MODULATOR AND A COMPLEX COMPRISING A CELL PENETRATING PEPTIDE, A CARGO AND A TLR PEPTIDE AGONIST FOR USE IN MEDICINE
Патент от
13 июня 2019 года

Заявител(и)ь: AMAL THERAPEUTICS SA

Изобретател(и)ь: Madiha DEROUAZI;Elodie BELNOUE

Номер заявки:

Дата заявки: 13.06.2019

Классификация: A61K39-0011, A61K47-66, C12N15-625, C07K16-2818, A61K39-3955, A61K2039-545, A61K47-42, C07K2-00, A61P35-00, A61K2039-507, C07K16-2878, A61K0047660000, A61K0039000000, C12N0015620000, C07K0016280000, A61K0039395000, A61K0047420000, C07K0002000000, A61P0035000000

Дата международной регистрации:

Международные идентификаторы:

Вес (релевантность к запросу): 1704.2134


... ; URL: http://cvc.dfci.harvard.edu/tadb/). Examples of cancer/tumor ... ; URL: http://cvc.dfci.harvard.edu/tadb/). Component c)—TLR Peptide Agonist ... isoforms is the extra domain A (EDA), which interacts with TLR4. Further ... TLR peptide agonists comprise a fibronectin EDA domain or a fragment or variant ... thereof. Such suitable fibronectin EDA domains or a fragments or variants ... NIDRPKGLAFTDVDVDSIKIAWESPQGQVSRYRVTYSSPEDGIRELFPAP DGEDDTAELQGLRPGSEYTVSVVALHDDMESQPLIGIQST (TLR4 peptide agonist EDA) In addition, high-mobility group ...
Combination of an immune checkpoint modulator and a complex comprising a cell penetrating peptide, a cargo and a TLR peptide agonist for use in medicine
Патент от
21 сентября 2017 года

Заявител(и)ь: Amal Therapeutics SA

Изобретател(и)ь:

Номер заявки:

Дата заявки: 21.09.2017

Классификация: A61K39-3955, A61K2039-505, A61K2039-545, A61P35-00, A61K39-0011, C07K16-2818, C07K16-2878, C07K2317-75, C07K2317-76, C07K2319-10, C07K2319-40, C12N15-625, A61K47-42, A61K47-66, A61K2039-507, C07K2-00, A61K0039000000

Дата международной регистрации:

Международные идентификаторы:

Вес (релевантность к запросу): 1704.2134


... ; URL: http://cvc.dfci.harvard.edu/tadb/). Examples of cancer/tumor ... ; URL: http://cvc.dfci.harvard.edu/tadb/). Component c) - T R peptide agonist In ... isoforms is the extra domain A (EDA), which interacts with TLR4. Further ... TLR peptide agonists comprise a fibronectin EDA domain or a fragment or variant ... thereof. Such suitable fibronectin EDA domains or a fragments or variants ... NO: 40 (TLR4 peptide agonist EDA) In addition, high-mobility group ...
КОМПОЗИЦИИ И СПОСОБЫ ДЛЯ МОДУЛИРОВАНИЯ ЭКСПРЕССИИ APOA1 И ABCA1
Патент от
29 мая 2015 года

Заявител(и)ь: РАНА ТЕРАПЬЮТИКС, ИНК.;ДЗЕ ДЖЕНЕРАЛ ХОСПИТАЛ КОРПОРЕЙШН д/б/а МАССАЧУСЕТС ДЖЕНЕРАЛ ХОСПИТАЛ

Изобретател(и)ь: Криг Артур М.;Субраманиан Ромеш;МакСвиджен Джеймс;Ли Джинни Т.

Номер заявки:

Дата заявки: 29.05.2015

Классификация: A61K31-7088, A61P3-06, A61P9-00, A61P9-10, A61K47-543, A61K47-62, C12N15-113, C12N2310-11, C12N2310-315, C12N2310-321, C12N2310-3231, C12N2310-346, C12N2310-351, C12N2310-3513, C12N2310-3515, A61K0048000000

Дата международной регистрации:

Международные идентификаторы:

Вес (релевантность к запросу): 1697.6257


... НЗ . PRC2 содержит четыре субъединицы: Eed, Suzl2, RbAp48 и Ezh2. Аспекты настоящего ... с антителом, которое специфично связывается с SUZ12, EED, EZH2 или RBBP4 (которые, как ... задействовано антитело, нацеленное на SUZ12, EED, EZH2 или RBBP4, или область ... задействовано антитело, специфически связывающееся с SUZ12, EED, EZH2 или RBBP4, или область ... Ezh2, но необязательно с субъединицами Suzl2, Eed, RbAp46/48 или дополнительными факторами ...
СПОСОБ СЕЛЕКТИВНОЙ ГИДРОГЕНИЗАЦИИ ДИНИТРИЛЬНОГО СОЕДИНЕНИЯ
Патент от
10 декабря 1998 года

Заявител(и)ь: DSM N.V. (NL);ДСМ Н.В. (NL)

Изобретател(и)ь: Fransiskus Khenrikus Antonius Marija Jozef Vandenboren (NL);Франсискус Хенрикус Антониус Мария Йозеф Ванденборен (NL);Khjubertus Jokhannes Mekhtilda Bosman (NL);Хюбертус Йоханнес Мехтилда Босман (NL);Jan Van Der Spul (NL);Ян Ван Дер Спул (NL)

Номер заявки: 95121823/04

Дата заявки: 10.12.1998

Классификация: C07C253-30 , 6C 07C 255/24 A, 6C 07C 253/30 B, 6C 07C 209/48 B, 6C 07C 211/09 B, 6 C 07 C 255/24, 253/30, 209/48, 211/09

Дата международной регистрации:

Международные идентификаторы:

Вес (релевантность к запросу): 1697.6257


... , AWW, BIK, CAS, CHA, EAB, EDT, ERI, CIS, JBW, KFI, LEV ... , AWW, BIK, CAS, CHA, EAB, EDI, ERI, CIS, JBW, KFI, LEV ... , BIK, CAS, CHA, DDR, EAB, EDI, ERI, GIS, JBW, KFI, LEV ... , BIK, CAS, CHA, DDR, EAB, EDI, ERI, GIS, JBW, KFI, LEV ... , BIK, CAS, CHA, DDR, EAB, EDI, ERI, GIS, JBW, KFI, LEV ...
BROADCAST DATA ACCESS CONTROLLER COMMUNICATION SYSTEM
Патент от
05 мая 1999 года

Заявител(и)ь: GLOBALSTAR L.P.

Изобретател(и)ь: MONTE, PAUL A.;BOWMAN, PHILIP J.;WIEDEMAN, ROBERT A.

Номер заявки:

Дата заявки: 05.05.1999

Классификация: H04H60-15, H04H60-23, H04L9-00, H04L9-083, H04L2209-601, H04N7-1675, H04N21-2347, H04N21-26613, H04N21-4405, H04L0009280000, H04L0009000000, H04L0009320000, H04N0007167000

Дата международной регистрации:

Международные идентификаторы:

Вес (релевантность к запросу): 1697.6257


... ). Also, the respective encryption algorithms EAT-EAn may include any suitable ... in accordance with encryption algorithm EAT, 3) the KG algorithm 7A and ... in accordance with encryption algorithm EAT is equal to the value ... each of the encryption algorithms EAT-EAn in a manner so that ... Encryption Algorithm Decryption Key P1 EAT 102 In Block AA of ...
SUTURES WITH NOTCH NEAR NEEDLE-SUTURE JUNCTION
Патент от
09 октября 1979 года

Заявител(и)ь:

Изобретател(и)ь: ACE, FRANKLIN S.

Номер заявки:

Дата заявки: 09.10.1979

Классификация: A61B17-06004, A61B2090-037, A61B0017040000, A61B0017060000, A61B0019000000

Дата международной регистрации:

Международные идентификаторы:

Вес (релевантность к запросу): 1697.6257


... the desired depth is formed. ETH- 39 The sutures suitable for ... about o.80 to about 0.92. ETH-3g2 The suture densities of ... still wet with tubing fluid. ETH-392 The tensile strength of ... strengths for the sutures were: ETH-392 RuPture Strength Examples (ounce ... actual values were as follows: ETH- 392 Rup t ure St length ...
COMPOSITIONS AND METHODS FOR TREATMENT OF T CELL MALIGNANCIES
Патент от
23 января 2020 года

Заявител(и)ь: THE GENERAL HOSPITAL CORPORATION

Изобретател(и)ь: MAUS, Marcela, V.

Номер заявки:

Дата заявки:

Классификация: C07K14-7051, C07K16-2809, C07K2317-622, C07K2319-03, C07K2319-33, C12N2510-00, C12N5-0636, C07K0014705000, C12N0005000000, C12N0009220000

Дата международной регистрации: 17.07.2019

Международные идентификаторы: WO/2020/018708, PCT/US2019/042268

Вес (релевантность к запросу): 1697.6257


... has reduced expression of CD3 eta or CD3 theta. In one ... comprises the ITAMs of CD3 eta (CD3e), CD3 theta (CD30), or ... is the ITAM of CD3 eta (CD3e), CD3 theta (CD30), or ... , having reduced expression of CD3 eta or CD3 theta. 39. The ... , having reduced expression of CD3 eta or CD3 theta. 39. The ...
Законодательное регулирование и применение доктрины ’’снятия корпоративной вуали” в российском праве и праве зарубежных стран: сравнительно-правовой анализ
Автореферат диссертации от
15 ноября 2020 года
14:34

Вес (релевантность к запросу): 1697.6257


... –1920. URL : https://www.academia.edu/8816146 (дата обращения: 09.06 ... ). URL : http://scholarship.law.duke.edu/cgi/viewcontent.cgi?article=1637 ... Entity. URL : http://open.mitchellhamline.edu/cgi/viewcontent.cgi?article=2772 ... ]. Режим доступа : https://www.academia.edu/8816146 (дата обращения: 09.06 ... ресурс]. URL : http://open.mitchellhamline.edu/cgi/viewcontent.cgi?article=2772 ...
Kationselektive Elektroden
Патент от
17 августа 1994 года

Заявител(и)ь: MONITORING TECH LTD

Изобретател(и)ь: BAND DAVID MARSTON;LINTON ROBERT ANTHONY FOX

Номер заявки:

Дата заявки: 17.08.1994

Классификация: G01N27-3335, A61B0005027500, G01N0027300000, G01N0027333000, G01N0027416000

Дата международной регистрации:

Международные идентификаторы:

Вес (релевантность к запросу): 1697.6257


... -cis-cyclohexane-1,2-dicarboxamide (ETH 1810 Fluka Chemicals). This lithium ... dioxaoctamethylene]-bis(12-methylaminododecanoate ETH 1001, Fluka Chemika). This calcium ... -N-diisobutyl-cis-cyclohexane-1,2-dicarboxamide (ETH 1810, Fluka Chemika). As mentioned ... -cyclo-hexane-1,2-dicarboxamide (ETH 1810, Fluka Chemika). An alternative ... ]-bis(12-methylamino-dodecanoate ETH 1001, Fluka Chemika). To form ...
Cation-selective polymeric electrodes
Патент от
07 марта 1995 года

Заявител(и)ь: Monitoring Technology Limited

Изобретател(и)ь: Band David M.;Linton Robert A. F.

Номер заявки:

Дата заявки: 07.03.1995

Классификация: G01N27-3335, A61B0005020000, G01N0027260000, A61B0005026000, A61B0005040000, A61B0005027500, G01N0027333000, G01N0027416000

Дата международной регистрации:

Международные идентификаторы:

Вес (релевантность к запросу): 1697.6257


... -cis-cyclohexane-1,2-dicarboxamide (ETH 1810 Fluka Chemicals). This lithium ... bis(12-methylamino-dodecan oate ETH 1001, Fluka Chemika). This calcium ... -N-diisobutyl-cis-cyclohexane-1,2-dicarboxamide (ETH 1810, Fluka Chemika). As mentioned ... -cyclo-hexane-1,2-dicarboxamide (ETH 1810, Fluka Chemika). An alternative ... ]-bis(1 2-methylamino-dodecanoate ETH 1001, Fluka Chemika). To form ...
CATION-SELECTIVE POLYMERIC ELECTRODES
Патент от
13 мая 1993 года

Заявител(и)ь: MONITORING TECHNOLOGY LIMITED

Изобретател(и)ь: BAND, DAVID MARSTON;LINTON, ROBERT ANTHONY FOX

Номер заявки:

Дата заявки: 13.05.1993

Классификация: G01N27-3335, G01N0027300000, A61B0005027500, G01N0027333000

Дата международной регистрации:

Международные идентификаторы:

Вес (релевантность к запросу): 1697.6257


... -cis-cyclohexane-1,2-dicarboxamide (ETH 1810 Fluka Chemicals). This lithium ... dioxaoctamethylene]-bis(12-methylaminododecanoate ETH 1001, Fluka Chemika). This calcium ... -N-diisobutyl-cis-cyclohexane-1,2-dicarboxamide (ETH 1810, Fluka Chemika). As mentioned ... -cyclo-hexane-1,2-dicarboxamide (ETH 1810, Fluka Chemika). An alternative ... ]-bis(12-methylamino-dodecanoate ETH 1001, Fluka Chemika). To form ...
Kationselektive Elektroden
Патент от
19 февраля 1998 года

Заявител(и)ь: MONITORING TECH LTD

Изобретател(и)ь: BAND DAVID;LINTON ROBERT

Номер заявки:

Дата заявки: 19.02.1998

Классификация: G01N27-3335, G01N0027300000, G01N0027333000, A61B0005027500

Дата международной регистрации:

Международные идентификаторы:

Вес (релевантность к запросу): 1697.6257


... diisobutylcis-cyclohexan-1,2-dicarboxamid (ETH 1810 Fluka Chemicals) enthält ... ]-bis(12-methylamino-dodecanoat) (ETH 1001, Fluka Chemika) enthält ... -N-diisobutyl-cis-cyclohexan-1,2-dicarboxamid (ETH 1810, Fluka Chemika) enthält ... -cyclo-hexan-1,2-dicarboxamid (ETH 1810, Fluka Chemika) enthält ... dioxaoctamethylen]- bis(12-methylamino-dodecanoat) (ETH 1001, Fluka Chemika) verwendet wird ...
ELECTRODOS DE POLIMERIZACION DE SELECTIVIDAD CATIONICA.
Патент от
16 декабря 1997 года

Заявител(и)ь: MONITORING TECHNOLOGY LIMITED

Изобретател(и)ь: BAND, DAVID, MARSTON;LINTON, ROBERT, ANTHONY, FOX

Номер заявки:

Дата заявки: 16.12.1997

Классификация: G01N27-3335, G01N0027333000, A61B0005027500, G01N0027416000

Дата международной регистрации:

Международные идентификаторы:

Вес (релевантность к запросу): 1697.6257


... -cis-ciclohexano-1,2-dicarboxamida (ETH 1810 Fluka Chemicals). Dicho ion ... ]-bis(12-metilamino-dodecanoato ETH 1001, Fluka Chemika). Este ion ... -N-diisobutil-cis-ciclohexano-1,2-dicarboxamida (ETH 1810, Fluka Chemika). Como se ... -cis-ciclohexano-1,2-dicarboxamida (ETH 1810, Fluka Chemika). Una membrana ... )]-bis(12-metilamino-dodecanoato ETH 1001, Fluka Chemika). Para formar ...
EXPRESSION OF HUMAN FOXP3 IN GENE EDITED T CELLS
Патент от
31 октября 2019 года

Заявител(и)ь: SEATTLE CHILDREN'S HOSPITAL (DBA SEATTLE CHILDREN'S RESEARCH INSTITUTE)

Изобретател(и)ь: SCHARENBERG, Andrew M.;RAWLINGS, David J.;SOMMER, Karen;HONAKER, Yuchi Chiang;KHAN, Iram F.;TORGERSON, Troy

Номер заявки:

Дата заявки:

Классификация: C07K14-4702, C12N2501-60, C12N2510-00, C12N5-0636, C12N9-22, C07K0014470000, C12N0005000000, C12N0009220000

Дата международной регистрации: 25.04.2019

Международные идентификаторы: WO/2019/210078, PCT/US2019/029159

Вес (релевантность к запросу): 1697.6257


... -2. [0556] By contrast, the edT rCg cells generated using AAV ... . [0575] A LNGFR staining experiment on edT rCg cells, post-microbead purification ... below. [0598] LNGFR+FOXP3+ edT rCg were detected in mice ... assays to determine whether the edT rCg generated using the exemplary ... Method 2, no irradiation of input edT rCg or mock cells was ...
Cell Penetrating Peptides and Complexes Comprising the Same
Патент от
17 мая 2018 года

Заявител(и)ь: Amal Therapeutics SA

Изобретател(и)ь: Madiha DEROUAZI

Номер заявки:

Дата заявки: 17.05.2018

Классификация: A61K2039-5154, A61K2039-6031, A61K38-17, A61K39-0011, A61K47-42, A61K47-64, A61P35-00, C07K2319-10, C07K2319-40, C12N2710-16233, A61K0047420000, A61K0038170000, A61K0039000000, A61P0035000000, A61K0047640000

Дата международной регистрации:

Международные идентификаторы:

Вес (релевантность к запросу): 1697.6257


... ; URL: http://cvc.dfci.harvard.edu/tadb/). Examples of tumor epitopes ... isoforms is the extra domain A (EDA), which interacts with TLR4. Further ... peptide agonists thus comprise a fibronectin EDA domain or a fragment or variant ... thereof. Such suitable fibronectin EDA domains or a fragments or variants ... -US-00007] (TLR4 peptide agonist EDA) [SEQ ID NO: 6] NIDRPKGLAFTDVDVDSIKIAWESPQGQVSRYRVTYSSPEDGIRELFPAP DGEDDTAELQGLRPGSEYTVSVVALHDDMESQPLIGIQST ...
Эволюция концепции общественного договора как принципа взаимодействия государства и общества в XXI веке
Автореферат диссертации от
20 ноября 2020 года
03:50

Вес (релевантность к запросу): 1697.6257


... доступа: https://www.iep.utm.edu/soc-cont/. Дата обращения 12 ... ]- Режим доступа: https://plato.stanford.edu/entries/contractarianism/. Дата обращения 20 ... ]- Режим доступа: https://plato.stanford.edu/entries/contractarianism/ Дата обращения 20 ... ]. - Режим доступа: https://plato.stanford.edu/entries/contractarianism/ 122. Локк Дж ... доступа: https://www.iep.utm.edu/soc-cont/ 136. Франция на ...
СПОСОБ И УСТРОЙСТВО ДЛЯ ИСПОЛЬЗОВАНИЯ УДАЛЕННОГО ЛОКОМОТИВА РАСПРЕДЕЛЕННОЙ ТЯГИ В КАЧЕСТВЕ РЕТРАНСЛЯТОРА В ЛИНИИ СВЯЗИ МЕЖДУ ГОЛОВНЫМ И ХВОСТОВЫМ УСТРОЙСТВАМИ ПОЕЗДА
Патент от
30 декабря 2011 года

Заявител(и)ь: ДЖЕНЕРАЛ ЭЛЕКТРИК КОМПАНИ;GENERAL ELECTRIC COMPANY

Изобретател(и)ь: Титер Дэвид Кэрролл;Смит Юджин;Корри Джеймс Глен;Фой Роберт Джеймс;Шмитц Джеймс П.;TEETER David, Carroll;SMITH Eugene;CORRY James, Glen;FOY Robert, James;SCHMITZ James, P.

Номер заявки:

Дата заявки: 30.12.2011

Классификация: B61L15-0027, H04B0007260000

Дата международной регистрации:

Международные идентификаторы:

Вес (релевантность к запросу): 1693.5364


... состоянии в устройство НОТ. Например, устройство EOT контролирует давление в тормозной магистрали в хвостовой ... устройством НОТ в ведущем локомотиве и устройством EOT в хвостовой части железнодорожного поезда. Железнодорожный ... для предупредительного светового сигнала EOT и оборудования связи EOT), работу предупредительного светового сигнала ... хранятся в обоих устройствах НОТ и EOT, и последовательные сообщения HOT/EOT содержат идентификационные данные ... по каналу связи HOT/EOT. Для принимающего устройства EOT ретранслированное сообщение выглядит как ... магистрали в хвостовой части поезда EOT (сообщаемые устройством EOT в устройство НОТ) имеют особое ... Периодические сообщения о состоянии от устройства EOT (например, о давлении в тормозной магистрали в хвостовой ... запрос информации о состоянии EOT. [0049] Аналогично, сообщения EOT (передаваемые приемопередатчиком EOT 44) принимаются ... из пневматической тормозной магистрали в устройстве EOT и предоставление сообщения о состоянии, например, о состоянии ... в течение работы системы HOT/EOT устройство EOT автоматически и периодически передает сообщения о состоянии ... сообщения HOT/EOT в приемопередатчик EOT 44 по каналу связи HOT/EOT. В этом примере ... на частоте сигнала HOT/EOT в устройство EOT 40. Устройство EOT 40 принимает и выполняет сообщение ... передает сообщение НОТ в устройство EOT 40. Устройство EOT 40 принимает сообщение так ... устройство НОТ 248R передает сообщение EOT в устройство EOT 40. [0077] При использовании ... формат сигнала HOT/EOT и передает сигнал в устройство EOT 40. Устройство EOT 40 при ... осуществления изобретения. Устройство EOT принимает модифицированное сообщение HOT/EOT, игнорирует заголовок и биты ... данного изобретения информацию о состоянии EOT от устройства EOT принимают в последнем удаленном локомотиве ... содержащим приемопередатчик головного устройства, и хвостовым (EOT) устройством, содержащим приемопередатчик хвостового устройства ... устройства ведущего локомотива и приемопередатчиком хвостового (EOT) устройства в хвостовой части железнодорожного поезда ...
СМЕСЬ МЕРКАПТОСИЛАНА С САЖЕЙ
Патент от
29 ноября 2017 года

Заявител(и)ь:

Изобретател(и)ь: БЛУМЕ Анке (DE);КЛОКМАНН Оливер (DE);BLUME Anke (DE);KLOKMANN Oliver (DE)

Номер заявки: 2014144103

Дата заявки: 29.11.2017

Классификация: C09C0001560000, C09C0003120000, C07F0007080000

Дата международной регистрации:

Международные идентификаторы:

Вес (релевантность к запросу): 1693.457


... -(CH 2-CH 2O) 2](EtO) 2Si(CH 2) 3-C(=O)-R 9, [319] [(C 11H 23O ... -(CH 2-CH 2O) 3](EtO) 2Si(CH 2) 3-C(=O)-R 9, [320] [(C 11H 23O ... -(CH 2-CH 2O) 4](EtO) 2Si(CH 2) 3-C(=O)-R 9, [321] [(C 11H 23O ... -(CH 2-CH 2O) 5](EtO) 2Si(CH 2) 3-C(=O)-R 9, [322] [(C 11H 23O ... -(CH 2-CH 2O) 6](EtO) 2Si(CH 2) 3-C(=O)-R 9, [323] [(C 12H 25O ... -(CH 2-CH 2O) 2](EtO) 2Si(CH 2) 3-C(=O)-R 9, [324] [(C 12H 25O ... -(CH 2-CH 2O) 3](EtO) 2Si(CH 2) 3-C(=O)-R 9, [325] [(C 12H 25O ... -(CH 2-CH 2O) 4](EtO) 2Si(CH 2) 3-C(=O)-R 9, [326] [(C 12H 25O ... -(CH 2-CH 2O) 5](EtO) 2Si(CH 2) 3-C(=O)-R 9, [327] [(C 12H 25O ... -(CH 2-CH 2O) 6](EtO) 2Si(CH 2) 3-C(=O)-R 9, [328] [(C 13H 27O ... -(CH 2-CH 2O) 2](EtO) 2Si(CH 2) 3-C(=O)-R 9, [329] [(C 13H 27O ... -(CH 2-CH 2O) 3](EtO) 2Si(CH 2) 3-C(=O)-R 9, [330] [(C 13H 27O ... -(CH 2-CH 2O) 4](EtO) 2Si(CH 2) 3-C(=O)-R 9, [331] [(C 13H 27O ... -(CH 2-CH 2O) 5](EtO) 2Si(CH 2) 3-C(=O)-R 9, [332] [(C 13H 27O ... -(CH 2-CH 2O) 6](EtO) 2Si(CH 2) 3-C(=O)-R 9, [333] [(C 14H 29O ... -(CH 2-CH 2O) 2](EtO) 2Si(CH 2) 3-C(=O)-R 9, [334] [(C 14H 29O ... -(CH 2-CH 2O) 3](EtO) 2Si(CH 2) 3-C(=O)-R 9, [335] [(C 14H 29O ... -(CH 2-CH 2O) 4](EtO) 2Si(CH 2) 3-C(=O)-R 9, [336] [(C 14H 29O ... -(CH 2-CH 2O) 5](EtO) 2Si(CH 2) 3-C(=O)-R 9, [337] [(C 14H 29O ... -(CH 2-CH 2O) 6](EtO) 2Si(CH 2) 3-C(=O)-R 9, [338] [(C 11H 23O ... -(CH 2-CH 2O) 2] 2(EtO)Si(CH 2) 3-C(=O)-R 9, [339] [(C 11H 23O ... -(CH 2-CH 2O) 3] 2(EtO)Si(CH 2) 3-C(=O)-R 9, [340] [(C 11H 23O ... -(CH 2-CH 2O) 4] 2(EtO)Si(CH 2) 3-C(=O)-R 9, [341] [(C 11H 23O ... -(CH 2-CH 2O) 5] 2(EtO)Si(CH 2) 3-C(=O)-R 9, [342] [(C 11H 23O ... -(CH 2-CH 2O) 6] 2(EtO)Si(CH 2) 3-C(=O)-R 9, [343] [(C 12H 25O ... -(CH 2-CH 2O) 2] 2(EtO)Si(CH 2) 3-C(=O)-R 9, [344] [(C 12H 25O ... -(CH 2-CH 2O) 3] 2(EtO)Si(CH 2) 3-C(=O)-R 9, [345] [(C 12H 25O ... -(CH 2-CH 2O) 4] 2(EtO)Si(CH 2) 3-C(=O)-R 9, [346] [(C 12H 25O ... -(CH 2-CH 2O) 5] 2(EtO)Si(CH 2) 3-C(=O)-R 9, [347] [(C 12H 25O ... -(CH 2-CH 2O) 6] 2(EtO)Si(CH 2) 3-C(=O)-R 9, [348] [(C 13H 27O ... -(CH 2-CH 2O) 2] 2(EtO)Si(CH 2) 3-C(=O)-R 9, [349] [(C 13H 27O ... -(CH 2-CH 2O) 3] 2(EtO)Si(CH 2) 3-C(=O)-R 9, [350] [(C 13H 27O ... -(CH 2-CH 2O) 4] 2(EtO)Si(CH 2) 3-C(=O)-R 9, [351] [(C 13H 27O ...
СПОСОБ ДВИЖЕНИЯ МУСКУЛЬНОГО ТРАНСПОРТНОГО СРЕДСТВА И МУСКУЛЬНОЕ ТРАНСПОРТНОЕ СРЕДСТВО ДЛЯ ЕГО ОСУЩЕСТВЛЕНИЯ
Патент от
28 февраля 2002 года

Заявител(и)ь: REVEO, INC.;FARIS, Sadeg, M.

Изобретател(и)ь: FARIS, Sadeg, M.

Номер заявки:

Дата заявки:

Классификация: G06Q20-02, G06Q20-04, G06Q20-32, G06Q20-322, G06Q20-3224, G06Q0020000000

Дата международной регистрации: 24.08.2001

Международные идентификаторы: WO/2002/017124, PCT/US2001/026619

Вес (релевантность к запросу): 1692.773


СПОСОБ ДВИЖЕНИЯ МУСКУЛЬНОГО ТРАНСПОРТНОГО СРЕДСТВА И МУСКУЛЬНОЕ ТРАНСПОРТНОЕ СРЕДСТВО ДЛЯ ЕГО ОСУЩЕСТВЛЕНИЯ. (EN) FIELD: transport. SUBSTANCE: proposed carrier comprises frame and wheels, two interconnected flutes arranged on both sides of said frame to turn about carriage, two rollers displacing in appropriate flute and turning on axle with slide block flange. Axle with pedal flange is secured to that slide block. Slide block can displace in the groove of block fitted on carriage axle. EFFECT: uniform wear of wheels. 3 cl, 9 dwg(RU) Мускульное транспортное средство содержит раму и колеса, два скрепленных между собой желоба, расположенные с обеих сторон рамы и имеющие возможность поворота вокруг каретки, два ролика, перемещающихся по соответствующему желобу и вращающихся на оси с буртом кулисного камня, к которому соосно закреплена ось с буртом педали. Кулисный камень имеет возможность перемещаться в пазу кулисы, закрепленной на валу каретки. Обеспечивается равномерный износ колес. 2 н. и 1 з.п. ф-лы, 9 ил. Oписание [1] Изобретение относится к мускульным транспортным средствам (далее - МТС), приводимым в движение мускульной силой человека, и может быть использовано как транспортное средство для передвижения человека с использованием его мускульной силы. [2] Заявленный способ движения МТС не имеет аналогов. [3] Уровень техники [4] В настоящее время все транспортные средства, приводимые в движение мускульной силой, имеют ведущие колеса (движители), на которые посредством мускульной силы и разнообразных известных трансмиссий (механических передач) [1] передается крутящий момент. Ведущие колеса, получая крутящий момент, взаимодействуют с дорогой (земной поверхностью) посредством силы трения, которая вызывает движение МТС. [5] Но известные трансмиссии и механические передачи крутящего момента от педалей на ведущие колеса в известных МТС конструктивно сложны, дороги в изготовлении и в обслуживании. Сложна и ненадежна система переключения передач. Ограничена скорость известных МТС из-за включения ног человека в ...
USE OF CIS-EPOXYEICOSATRIENOIC ACIDS AND INHIBITORS OF SOLUBLE EPOXIDE HYDROLASE TO TREAT CONDITIONS MEDIATED BY PBR, CB2, and NK2 RECEPTORS
Патент от
21 февраля 2013 года

Заявител(и)ь: Hammock Bruce D.;Inceoglu Ahmet Bora

Изобретател(и)ь: Hammock Bruce D.;Inceoglu Ahmet Bora

Номер заявки:

Дата заявки: 21.02.2013

Классификация: A61K31-335, A61K31-17, A61K31-192, A61K31-202, A61K31-336, A61K31-365, A61K31-415, A61K31-60, A61K0031558000, A61P0025080000, A61P0025300000, C12N0005071000, A61Q0017040000, A61P0001000000, C12N0005090000, A61P0025220000, A61P0017180000

Дата международной регистрации:

Международные идентификаторы:

Вес (релевантность к запросу): 1692.554


... consisting of a cis-epoxyeicosantrienoic acid (“EET”), an inhibitor of soluble epoxide ... of 14,15-BET, 8,9-EET, 11,12-EET or 5,6-EET. In some embodiments ... consisting of a cis-epoxyeicosantrienoic acid (“EET”), an inhibitor of soluble epoxide ... consisting of a cis-epoxyeicosantrienoic acid (“EET”), an inhibitor of soluble epoxide ... of 14,15-BET, 8,9-EET and 11,12-EET. In some embodiments ... consisting of a cis-epoxyeicosantrienoic acid (“EET”), an inhibitor of soluble epoxide ... consisting of 14,15-EET, 8,9-EET, and 11,12-EET. In some embodiments ... 11195. Filled diamonds: 5,6-EET. Filled circles: 11,12-EET. Filled triangles: 14 ... ,15-EET. Filled squares: Mixture ... increasing order of desirability, the EET or EETs are administered ... the inhibitor. Most preferably, the EET or EETs are administered concurrently ... include 14,15-LET, 8,9-EET and 11,12-EET, and 5,6 EETs. Preferably ... and 14R,15S-EET. 8,9-EET, 11,12-EET, and 14R,15S-EET, are commercially ... the invention, the sEH inhibitor, EET, or combination thereof, is ... isomers of EETs (Table 2). Additionally 5,6-EET remained to have the same ... BZD (peripheral) 5,6-EET 27 PK11195 2.5E−09 BZD (peripheral) 8,9-EET 11 PK11196 ... PK11195 2.5E−09 Cannabinoid CB2 5,6-EET 25 WINS5212-2 2.7E−09 ... Cannabinoid CB2 8,9-EET −2 WING5212-2 2.7E−09 Cannabinoid ... Dopamine D3 5,6-EET 18 (+)butaclamol 8.7E−09 Dopamine D3 8,9-EET 9 (+)butaclamol 8.7E ... butaclamol 8.7E−09 Neurokinin NK2 5,6-EET 25 [Nle10]- 9.7E−09 NKA ... (4.10) Neurokinin NK2 8,9-EET 10 [Nle101- 9.7E−09 ... NK2 NK3 benzodiazepine benzodiazepine D3 EET-me mixture (μM) >100  19 > ... consisting of a cis-epoxyeicosantrienoic acid (“EET”), an inhibitor of soluble epoxide ... consisting of a cis-epoxyeicosantrienoic acid (“EET”), an inhibitor of soluble epoxide ... consisting of a cis-epoxyeicosantrienoic acid (“EET”), an inhibitor of soluble epoxide ... consisting of 14,15-EET, 8,9-EET and 11,12-EET. 17. A method of ... consisting of a cis-epoxyeicosantrienoic acid (“EET”), an inhibitor of soluble epoxide ...
MIXTURE OF FUNCTIONALISED POLYMERS FOR TIRES
Патент от
20 марта 2019 года

Заявител(и)ь:

Изобретател(и)ь: ХАМАНН Эвемари (DE);ХАЙДЕНРАЙХ Даниель (DE);ТИЛЕ Свен (DE);HAMANN, Evemarie (DE);HEIDENREICH, Daniel (DE);THIELE, Sven (DE)

Номер заявки: 2017132265

Дата заявки: 20.03.2019

Классификация: B60C1-00, C08C19-20, C08C19-22, C08C19-25, C08C19-44, C08L9-06, C08L2205-025, B60C1-0016, B60C1-0025, B60C0001000000, C08L0009060000, C08C0019200000, C08C0019250000, C08C0019440000, C08C0019220000

Дата международной регистрации:

Международные идентификаторы:

Вес (релевантность к запросу): 1692.4861


... 3, (MeO) 3Si-CH 2-S-SiMe 3, (EtO) 3Si-CH 2-S-SiMe 3, (PrO ... 3, (MeO) 3Si-CH 2-S-SiEt 3, (EtO) 3Si-CH 2-S-SiEt 3, (PrO ... 2MeSi-(CH 2) 3-S-SiMe 3, (EtO) 2MeSi-(CH 2) 3-S-SiMe ... 2MeSi-(CH 2) 2-S-SiMe 3, (EtO) 2MeSi-(CH 2) 2-S-SiMe ... 3, (MeO) 2MeSi-CH 2-S-SiMe 3, (EtO) 2MeSi-CH 2-S-SiMe 3, (PrO ... (H)Me-CH 2-S-SiMe 3, (EtO) 2MeSi-CH 2-C(H)Me-CH ... 2MeSi-(CH 2) 3-S-SiEt 3, (EtO) 2MeSi-(CH 2) 3-S-SiEt ... 2MeSi-(CH 2) 2-S-SiEt 3, (EtO) 2MeSi-(CH 2) 2-S-SiEt ... 3, (MeO) 2MeSi-CH 2-S-SiEt 3, (EtO) 2MeSi-CH 2-S-SiEt 3, (PrO ... 2MeSi-CH 2-S-SiMe 2tBu, (EtO) 2MeSi-CH 2-S-SiMe 2tBu ... Me) 2-S-(CH 2) 3-Si(OEt) 3, (EtO) 3Si-(CH 2) 3-S-Si ... Et) 2-S-(CH 2) 3-Si(OEt) 3, (EtO) 3Si-(CH 2) 3-S-Si ... Bu) 2-S-(CH 2) 2-Si(OMe) 3, (EtO) 3Si-(CH 2) 2-S-Si ... Me) 2-S-(CH 2) 2-Si(OEt) 3, (EtO) 3Si-(CH 2) 2-S-Si ... Et) 2-S-(CH 2) 2-Si(OEt) 3, (EtO) 3Si-(CH 2) 2-S-Si ... ) 2-S-(CH 2) 3-Si(OMe) 2(Me), (EtO) 2(Me)Si-(CH 2) 3-S- ... ) 2-S-(CH 2) 3-Si(OEt) 2(Me), (EtO) 2(Me)Si-(CH 2) 3-S- ... ) 2-S-(CH 2) 3-Si(OEt) 2(Me), (EtO) 2(Me)Si-(CH 2) 3-S- ... ) 2-S-(CH 2) 2-Si(OMe) 2(Me), (EtO) 2(Me)Si-(CH 2) 2-S- ... ) 2-S-(CH 2) 2-Si(OEt) 2(Me), (EtO) 2(Me)Si-(CH 2) 2-S- ... ) 2-S-(CH 2) 2-Si(OEt) 2(Me), (EtO) 2(Me)Si-(CH 2) 2-S- ... Bu) 2-S-(CH 2) 3-Si(OMe) 3, (EtO) 3Si-(CH 2) 3-S-Sn ... Me) 2-S-(CH 2) 3-Si(OEt) 3, (EtO) 3Si-(CH 2) 3-S-Sn ... Et) 2-S-(CH 2) 3-Si(OEt) 3, (EtO) 3Si-(CH 2) 3-S-Sn ... Bu) 2-S-(CH 2) 2-Si(OMe) 3, (EtO) 3Si-(CH 2) 2-S-Sn ... Me) 2-S-(CH 2) 2-Si(OEt) 3, (EtO) 3Si-(CH 2) 2-S-Sn ... Et) 2-S-(CH 2) 2-Si(OEt) 3, (EtO) 3Si-(CH 2) 2-S-Sn ... ) 2-S-(CH 2) 3-Si(OMe) 2(Me), (EtO) 2(Me)Si-(CH 2) 3-S- ... ) 2-S-(CH 2) 3-Si(OEt) 2(Me), (EtO) 2(Me)Si-(CH 2) 3-S- ... ) 2-S-(CH 2) 3-Si(OEt) 2(Me), (EtO) 2(Me)Si-(CH 2) 3-S- ... ) 2-S-(CH 2) 2-Si(OMe) 2(Me), (EtO) 2(Me)Si-(CH 2) 2-S- ... CH 2) 2-Si(OEt) 2(Me), (EtO) 2(Me)Si-(CH 2) 2-S- ... CH 2) 2-Si(OEt) 2(Me), (EtO) 2(Me)Si-(CH 2) 2-S- ... не ограничиваясь этим, Si 230 (EtO) 3Si(CH 2) 3CI, Si 225 ... (EtO) 3SiCH=CH 2, A189 [243] (EtO) 3Si(CH 2) 3SH ... ) 3Si(CH 2) 3S 2] 2, Si 264 (EtO) 3Si- (CH 2) 3SCN, и Si ... не ограничиваясь этим, Si 203 (EtO) 3-Si-C 3H 7, и Si ... метокси- (MeO), этокси- (EtO), пропокси- (PrO), бутокси- ...
USE OF CIS-EPOXYEICOSATRIENOIC ACIDS AND INHIBITORS OF SOLUBLE EPOXIDE HYDROLASE TO TREAT CONDITIONS MEDIATED BY PBR, CB2, AND NK2 RECEPTORS
Патент от
19 июня 2008 года

Заявител(и)ь: REGENTS OF THE UNIVERSITY OF CALIFORNIA;HAMMOCK, Bruce D.;INCEOGLU, Ahmet Bora

Изобретател(и)ь: HAMMOCK, Bruce D.;INCEOGLU, Ahmet Bora

Номер заявки:

Дата заявки:

Классификация: A61K31-17, A61K31-192, A61K31-202, A61K31-335, A61K31-336, A61K31-365, A61K31-415, A61K31-60, A61P1-00, A61P17-16, A61P17-18, A61P25-00, A61P25-08, A61P25-18, A61P25-22, A61P25-30, A61P25-32, A61P25-36, A61P35-00, A61K0031336000, A61K0031335000, A61K0048000000, A61K0031170000, A61K0031600000, A61K0031365000, A61K0031415000, A61K0031202000, A61K0031192000

Дата международной регистрации: 04.01.2007

Международные идентификаторы: WO/2008/073130, PCT/US2007/000373

Вес (релевантность к запросу): 1692.4502


... consisting of a czs-epoxyeicosantrienoic acid ("EET"), an inhibitor of soluble epoxide ... the EET is selected from the group consisting of 14,15-EET, 8,9-EET ... , 11,12-EET or 5,6-EET. In some embodiments ... consisting of a c/s-epoxyeicosantrienoic acid ("EET"), an inhibitor of soluble epoxide ... consisting of a cw-epoxyeicosantrienoic acid ("EET"), an inhibitor of soluble epoxide ... consisting of 14,15-EET, 8,9-EET and 11,12-EET. In some embodiments ... consisting of a c/s-epoxyeicosantrienoic acid ("EET"), an inhibitor of soluble epoxide ... consisting of 14,15-EET, 8,9-EET, and 11,12-EET. In some embodiments ... 11195. Filled diamonds: 5,6-EET. Filled circles: 11,12-EET. Filled triangles: 14 ... ,15-EET. Filled squares: Mixture ... increasing order of desirability, the EET or EETs are administered within ... the inhibitor. Most preferably, the EET or EETs are administered concurrently ... is surmised that the exogenous EET overwhelms endogenous sEH, and allows ... invention include 14, 15-EET, 8,9-EET and 11,12-EET, and 5,6 EETs. Preferably ... and 14R,15S-EET. 8,9-EET, 11,12-EET, and 14R,15S-EET, are commercially ... substitutions or alterations in an EET, and include structural analogs in ... release material. [0069] Conveniently, the EET or EETs can be administered ... the invention, the sEH inhibitor, EET, or combination thereof, is dissolved ... isomers of EETs (Table 2). Additionally 5,6-EET remained to have the same ... results in clear increases in EET concentrations. Our data implies that ... consisting of a c/s-epoxyeicosantrienoic acid ("EET"), an inhibitor of soluble epoxide ... of 14, 15-EET5 8,9-EET, 11,12-EET or 5,6-EET. 4. A method of claim ... consisting of a c/Ls-epoxyeicosantrienoic acid ("EET"), an inhibitor of soluble epoxide ... consisting of a c/s-epoxyeicosantrienoic acid ("EET"), an inhibitor of soluble epoxide ... consisting of 14, 15-EET, 8,9-EET and 11 , 12-EET. 17. A method of ... consisting of a m-epoxyeicosantrienoic acid ("EET"), an inhibitor of soluble epoxide ... consisting of 14,15-EET, 8,9-EET, and 11,12-EET. 23. A method of ...
TIRE FOR WHEELS OF VEHICLES
Патент от
10 июля 2020 года

Заявител(и)ь:

Изобретател(и)ь: ДЕ КАНЧЕЛЛИС Пьерлуиджи (IT);ХАНЕЛ Томас (IT);ПАРАЦЦОЛИ Франческо (IT);РАТТИ Джузеппина (IT);ВАГЕМАНН Юрген (IT);ЦИННА Марианна (IT);DE CANCELLIS, Pierluigi (IT);HANEL, Thomas (IT);PARAZZOLI, Francesco (IT);RATTI, Giuseppina (IT);WAGEMANN, Juergen (IT);ZINNA, Marianna (IT)

Номер заявки: 2018146489

Дата заявки: 10.07.2020

Классификация: B60C1-0016, B60C2011-016, B60C2200-06, B60C2200-10, B60C2200-14, C08L9-00, C08L9-06, B60C1-00, B60C1-0025, B60C2001-0058, C08L2205-03, C08L2207-04, B60C0001000000

Дата международной регистрации:

Международные идентификаторы:

Вес (релевантность к запросу): 1692.3348


... метокси- (MeO), этокси- (EtO), пропокси- (PrO), бутокси- ... 3Si-(CH 2) 3-S-SiMe 3, (EtO) 3Si-(CH 2) 3-S-SiMe ... 3Si-(CH 2) 2-S-SiMe 3, (EtO) 3Si-(CH 2) 2-S-SiMe ... 3, (MeO) 3Si-CH 2-S-SiMe 3, (EtO) 3Si-CH 2-S-SiMe 3, (PrO ... 3, (MeO) 3Si-CH 2-S-SiEt 3, (EtO) 3Si-CH 2-S-SiEt 3, (PrO ... ) 2MeSi-(CH 2) 3-S-SiMe 3, (EtO) 2MeSi-(CH 2) 3-S-SiMe ... ) 2MeSi-(CH 2) 2-S-SiMe 3, (EtO) 2MeSi-(CH 2) 2-S-SiMe ... 3, (MeO) 2MeSi-CH 2-S-SiMe 3, (EtO) 2MeSi-CH 2-S-SiMe 3, (PrO ... 2-C(H)Me-CH 2-S-SiMe 3, (EtO) 2MeSi-CH 2-C(H)Me-CH ... ) 2MeSi-(CH 2) 3-S-SiEt 3, (EtO) 2MeSi-(CH 2) 3-S-SiEt ... ) 2MeSi-(CH 2) 2-S-SiEt 3, (EtO) 2MeSi-(CH 2) 2-S-SiEt ... 3, (MeO) 2MeSi-CH 2-S-SiEt 3, (EtO) 2MeSi-CH 2-S-SiEt 3, (PrO ... 2-C(H)Me-CH 2-S-SiEt 3, (EtO) 2MeSi-CH 2-C(H)Me-CH ... ) 2MeSi-CH 2-S-SiMe 2tBu, (EtO) 2MeSi-CH 2-S-SiMe 2tBu ... (Bu) 2-S-(CH 2) 3-Si(OMe) 3,(EtO) 3Si-(CH 2) 3-S-Si ... (Me) 2-S-(CH 2) 3-Si(OEt) 3, (EtO) 3Si-(CH 2) 3-S-Si ... (Et) 2-S-(CH 2) 3-Si(OEt) 3, (EtO) 3Si-(CH 2) 3-S-Si ... (Bu) 2-S-(CH 2) 2-Si(OMe) 3, (EtO) 3Si-(CH 2) 2-S-Si ... (Me) 2-S-(CH 2) 2-Si(OEt) 3, (EtO) 3Si-(CH 2) 2-S-Si ... (Et) 2-S-(CH 2) 2-Si(OEt) 3, (EtO) 3Si-(CH 2) 2-S-Si ... ) 2-S-(CH 2) 3-Si(OMe) 2(Me), (EtO) 2(Me)Si-(CH 2) 3-S- ... ) 2-S-(CH 2) 3-Si(OEt) 2(Me), (EtO) 2(Me)Si-(CH 2) 3-S- ... ) 2-S-(CH 2) 3-Si(OEt) 2(Me), (EtO) 2(Me)Si-(CH 2) 3-S- ... ) 2-S-(CH 2) 2-Si(OMe) 2(Me), (EtO) 2(Me)Si-(CH 2) 2-S- ... ) 2-S-(CH 2) 2-Si(OEt) 2(Me), (EtO) 2(Me)Si-(CH 2) 2-S- ... ) 2-S-(CH 2) 2-Si(OEt) 2(Me), (EtO) 2(Me)Si-(CH 2) 2-S- ... (Bu) 2-S-(CH 2) 3-Si(OMe) 3, (EtO) 3Si-(CH 2) 3-S-Sn ... (Me) 2-S-(CH 2) 3-Si(OEt) 3, (EtO) 3Si-(CH 2) 3-S-Sn ... (Et) 2-S-(CH 2) 3-Si(OEt) 3, (EtO) 3Si-(CH 2) 3-S-Sn ... (Bu) 2-S-(CH 2) 2-Si(OMe) 3, (EtO) 3Si-(CH 2) 2-S-Sn ... (Me) 2-S-(CH 2) 2-Si(OEt) 3, (EtO) 3Si-(CH 2) 2-S-Sn ... (Et) 2-S-(CH 2) 2-Si(OEt) 3, (EtO) 3Si-(CH 2) 2-S-Sn ... ) 2-S-(CH 2) 3-Si(OMe) 2(Me), (EtO) 2(Me)Si-(CH 2) 3-S- ... ) 2-S-(CH 2) 3-Si(OEt) 2(Me), (EtO) 2(Me)Si-(CH 2) 3-S- ... ) 2-S-(CH 2) 3-Si(OEt) 2(Me), (EtO) 2(Me)Si-(CH 2) 3-S- ... ) 2-S-(CH 2) 2-Si(OMe) 2(Me), (EtO) 2(Me)Si-(CH 2) 2-S- ... ) 2-S-(CH 2) 2-Si(OEt) 2(Me), (EtO) 2(Me)Si-(CH 2) 2-S- ... ) 2-S-(CH 2) 2-Si(OEt) 2(Me), (EtO) 2(Me)Si-(CH 2) 2-S- ...
Methods, apparatus and systems for monitoring CO2
Патент от
28 апреля 2011 года

Заявител(и)ь: Joshua Lewis Colman;ORIDION MEDICAL 1987 LTD.;Iris Shalev Stein

Изобретател(и)ь: Joshua Lewis Colman;Iris Shalev Stein

Номер заявки:

Дата заявки: 28.04.2011

Классификация: A61B0005080000, A61B0005000000, A61M0016080000, A61B0005020500, A61B0005083000, A61B0005097000, A61M0005172000, G06N0005040000, A61M0016040000, A61M0016000000, A61M0016100000, A61B0005021000, A61B0005024000, A61B0005040200, A61B0005047600, A61B0005087000

Дата международной регистрации:

Международные идентификаторы:

Вес (релевантность к запросу): 1691.9529


... includes inserting an endotrachial tube (ETT) to a subject in a need ... second tube. The endotrachial tube (ETT) may be a double lumen ... endotrachial tube (ETT) having a main endotrachial tube and ... provided a double lumen endotrachial tube (ETT) adapted for sampling breath from ... the double lumen endotrachial tube (ETT) includes a main endotrachial tube and ... including a double lumen endotrachial tube (ETT) adapted for sampling breath from ... the double lumen endotrachial tube (ETT) includes a main endotrachial tube and ... the double lumen endotrachial tube (ETT) through a connector. The endotrachial tube ... (ETT) may be a double lumen endotrachial ... tube (ETT) having a main endotrachial tube and ... some embodiments, the endotrachial tube (ETT) may be an uncuffed ... of a double lumen endotrachial tube (ETT) and a sampling opening adapted ... of a double lumen endotrachial tube (ETT). According to some embodiments, particularly ... shows a double lumen Endotrachial Tube (ETT), according to some embodiments. Endotrachial ... Tube (double lumen ETT) 100 includes a main endotrachial tube ... for example through a double lumen ETT, produced a significantly better or at ... shows a double lumen Endotrachial Tube (ETT), according to some embodiments. Endotrachial ... Tube (double lumen ETT) 200 includes a main endotrachial tube ... avoidance of doubt, a “double lumen ETT” or “double lumen endotrachial tube ... shows a double lumen Endotrachial Tube (ETT), according to some embodiments. Endotrachial ... Tube (double lumen ETT) 300 includes a main endotrachial tube ... of the double lumen ETT or any ETT in addition or instead ... the proximal end of the ETT (Philips IntelliVue patient monitor, ... using a double lumen endotracheal tube (ETT), wherein the double lumen endotracheal ... tube (ETT) comprises a main endotracheal tube and ... is an uncuffed endotracheal tube (ETT). 8. The method of claim 1, further ...